Solution NMR structure of SACOL0876 from Staphylococcus aureus COL, NESG target ZR353 and CSGID target IDP00841
MHHHHHHSSG VDLGTENLYF QSNAMIKFYQ YKNCTTCKKA AKFLDEYGVS YEPIDIVQHT PTINEFKTII ANTGVEINKL FNTHGAKYRE LDLKNKLQTL SDDEKLELLS SDGMLVKRPL AVMGDKITLG FKEDQYKETW LA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.3 % (1335 of 1705) | 79.0 % (699 of 885) | 77.7 % (518 of 667) | 77.1 % (118 of 153) |
Backbone | 81.7 % (691 of 846) | 81.7 % (236 of 289) | 82.1 % (343 of 418) | 80.6 % (112 of 139) |
Sidechain | 76.1 % (756 of 993) | 77.7 % (463 of 596) | 74.9 % (287 of 383) | 42.9 % (6 of 14) |
Aromatic | 51.9 % (83 of 160) | 65.0 % (52 of 80) | 38.0 % (30 of 79) | 100.0 % (1 of 1) |
Methyl | 86.8 % (132 of 152) | 86.8 % (66 of 76) | 86.8 % (66 of 76) |
1. SACOL0876
MHHHHHHSSG VDLGTENLYF QSNAMIKFYQ YKNCTTCKKA AKFLDEYGVS YEPIDIVQHT PTINEFKTII ANTGVEINKL FNTHGAKYRE LDLKNKLQTL SDDEKLELLS SDGMLVKRPL AVMGDKITLG FKEDQYKETW LASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Solvent system 99% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
9 | TRIS | [U-100% 2H] | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | DTT | [U-100% 2H] | 10 mM | |
12 | NaN3 | natural abundance | 0.01 % | |
13 | benzamidine | natural abundance | 10 mM | |
14 | inhibitor cocktail | natural abundance | 1 na |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SACOL0876 | [U-7% 13C; U-100% 15N] | 0.2 mM | |
16 | TRIS | [U-100% 2H] | 10 mM | |
17 | sodium chloride | natural abundance | 300 mM | |
18 | DTT | [U-100% 2H] | 10 mM | |
19 | NaN3 | natural abundance | 0.01 % | |
20 | benzamidine | natural abundance | 10 mM | |
21 | inhibitor cocktail | natural abundance | 1 na |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TRIS | [U-100% 2H] | 10 mM | |
3 | sodium chloride | natural abundance | 300 mM | |
4 | DTT | [U-100% 2H] | 10 mM | |
5 | NaN3 | natural abundance | 0.01 % | |
6 | benzamidine | natural abundance | 10 mM | |
7 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 800 MHz
State isotropic, Solvent system 99% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | SACOL0876 | [U-100% 13C; U-100% 15N] | 0.3 mM | |
9 | TRIS | [U-100% 2H] | 10 mM | |
10 | sodium chloride | natural abundance | 300 mM | |
11 | DTT | [U-100% 2H] | 10 mM | |
12 | NaN3 | natural abundance | 0.01 % | |
13 | benzamidine | natural abundance | 10 mM | |
14 | inhibitor cocktail | natural abundance | 1 na |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | SACOL0876 | [U-7% 13C; U-100% 15N] | 0.2 mM | |
16 | TRIS | [U-100% 2H] | 10 mM | |
17 | sodium chloride | natural abundance | 300 mM | |
18 | DTT | [U-100% 2H] | 10 mM | |
19 | NaN3 | natural abundance | 0.01 % | |
20 | benzamidine | natural abundance | 10 mM | |
21 | inhibitor cocktail | natural abundance | 1 na |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_18987_2m46.nef |
Input source #2: Coordindates | 2m46.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------------------------------10--------20--------30--------40--------50--------60--------70------ MHHHHHHSSGVDLGTENLYFQSNAMIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MHHHHHHSSGVDLGTENLYFQSNAMIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --80--------90-------100-------110-------- SDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA |||||||||||||||||||||||||||||||||||||||||| SDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA -------110-------120-------130-------140--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_18987_2m46.nef
Assigned chemical shifts
--------------------------------10--------20--------30--------40--------50--------60--------70------ MHHHHHHSSGVDLGTENLYFQSNAMIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTL ||||||| ||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||| ........................MIKFYQY....TCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFN.HG.KYRELDLKNKLQTL --80--------90-------100-------110-------- SDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA |||||||||||||||||||||||||||||||||||||||||| SDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
36 | THR | HG1 | 5.247 |
49 | THR | HG1 | 4.217 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 885 | 674 | 76.2 |
13C chemical shifts | 667 | 487 | 73.0 |
15N chemical shifts | 155 | 109 | 70.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 289 | 219 | 75.8 |
13C chemical shifts | 284 | 212 | 74.6 |
15N chemical shifts | 139 | 103 | 74.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 596 | 455 | 76.3 |
13C chemical shifts | 383 | 275 | 71.8 |
15N chemical shifts | 16 | 6 | 37.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 67 | 83.8 |
13C chemical shifts | 80 | 67 | 83.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 80 | 48 | 60.0 |
13C chemical shifts | 79 | 26 | 32.9 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------------------------------10--------20--------30--------40--------50--------60--------70------ MHHHHHHSSGVDLGTENLYFQSNAMIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTL ||||||| ||||||||||||||||||||||||||||||||||||||||||||||| || |||||||||||||| ........................MIKFYQY....TCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFN.HG.KYRELDLKNKLQTL --80--------90-------100-------110-------- SDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA |||||||||||||||||| ||||||||||||||||||||||| SDDEKLELLSSDGMLVKR.LAVMGDKITLGFKEDQYKETWLA
Dihedral angle restraints
--------------------------------10--------20--------30--------40--------50--------60--------70------ MHHHHHHSSGVDLGTENLYFQSNAMIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTL |||||||| ||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||| ........................MIKFYQYK..TTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLF....AKYRELDLKNKLQTL --------------------------------10--------20--------30--------40--------50--------60--------70------ --80--------90-------100-------110-------- SDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA ||||||||||||||||| ||||||||||||||||||||||| SDDEKLELLSSDGMLVK.PLAVMGDKITLGFKEDQYKETWL --80--------90-------100-------110-------