40-residue beta-amyloid fibril derived from Alzheimer's disease brain
Polymer type: polypeptide(L)
Total | 13C | 15N | |
---|---|---|---|
All | 91.8 % (201 of 219) | 90.4 % (160 of 177) | 97.6 % (41 of 42) |
Backbone | 96.8 % (149 of 154) | 96.5 % (110 of 114) | 97.5 % (39 of 40) |
Sidechain | 85.9 % (85 of 99) | 85.6 % (83 of 97) | 100.0 % (2 of 2) |
Aromatic | 48.0 % (12 of 25) | 48.0 % (12 of 25) | |
Methyl | 100.0 % (23 of 23) | 100.0 % (23 of 23) |
1. beta-amyloid peptide
DAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGVVSolvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian Infinity - 750 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian Infinity - 750 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian Infinity - 750 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian Infinity - 750 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 600 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian InfinityPlus - 400 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Varian Infinity - 750 MHz
State solid, Solvent system none, Pressure 1 atm, Temperature 273 K, pH 7.4, Details 40-residue beta-amyloid peptide seeded with amyloid extracted from brain tissue. Lyophilized, then rehydrated after packing in MAS rotor.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | beta-amyloid peptide | selectively and uniformly labeled samples | 1.0 ~ 2.0 mg |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19009_2m4j.nef |
Input source #2: Coordindates | 2m4j.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 40 | 0 | 0 | 100.0 |
B | B | 40 | 0 | 0 | 100.0 |
C | C | 40 | 0 | 0 | 100.0 |
D | D | 40 | 0 | 0 | 100.0 |
E | E | 40 | 0 | 0 | 100.0 |
F | F | 40 | 0 | 0 | 100.0 |
G | G | 40 | 0 | 0 | 100.0 |
H | H | 40 | 0 | 0 | 100.0 |
I | I | 40 | 0 | 0 | 100.0 |
Content subtype: combined_19009_2m4j.nef
Assigned chemical shifts
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1 | ASP | CG | 178.2 |
3 | GLU | CD | 182.0 |
5 | ARG | CZ | 159.2 |
6 | HIS | CG | 136.8 |
7 | ASP | CG | 180.0 |
10 | TYR | CG | 129.1 |
10 | TYR | CZ | 157.7 |
11 | GLU | CD | 183.3 |
13 | HIS | CG | 139.4 |
15 | GLN | CD | 176.3 |
19 | PHE | CG | 142.2 |
20 | PHE | CG | 141.7 |
22 | GLU | CD | 181.9 |
23 | ASP | CG | 178.0 |
27 | ASN | CG | 182.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 177 | 160 | 90.4 |
15N chemical shifts | 43 | 41 | 95.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 80 | 77 | 96.3 |
15N chemical shifts | 40 | 39 | 97.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 97 | 83 | 85.6 |
15N chemical shifts | 3 | 2 | 66.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 24 | 24 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 25 | 12 | 48.0 |
Distance restraints
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||| |||| |||||||||||||||||||||||||| DAEFRHDS.YEVH.QKLVFFAEDVGSNKGAIIGLMVGGVV
Dihedral angle restraints
--------10--------20--------30--------40 DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |||||||||||||||||||||||||||||||||||||||| DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV