Backbone 1H, 13C, and 15N Chemical Shift Assignments for rubredoxin type protein from Mycobacterium ulcerans
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.7 % (527 of 630) | 81.6 % (271 of 332) | 84.0 % (205 of 244) | 94.4 % (51 of 54) |
Backbone | 96.6 % (315 of 326) | 96.5 % (109 of 113) | 96.3 % (156 of 162) | 98.0 % (50 of 51) |
Sidechain | 74.0 % (262 of 354) | 74.0 % (162 of 219) | 75.0 % (99 of 132) | 33.3 % (1 of 3) |
Aromatic | 30.9 % (21 of 68) | 50.0 % (17 of 34) | 12.5 % (4 of 32) | 0.0 % (0 of 2) |
Methyl | 84.6 % (22 of 26) | 84.6 % (11 of 13) | 84.6 % (11 of 13) |
1. rubredoxin type protein
MTAYRCPVCD YTYDEGKGDP REGFPAGTRW DQIPDDWCCP DCSVREKVDF ERMGGKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Bruker AMX - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | rubredoxin type protein | [U-98% 15N] | 1.2 mM | |
2 | rubredoxin type protein | [U-95% 13C; U-95% 15N] | 1.4 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19027_2m4y.nef |
Input source #2: Coordindates | 2m4y.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50------ MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 56 | 0 | 0 | 100.0 |
Content subtype: combined_19027_2m4y.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50------ MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
32 | GLN | CD | 180.62 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 332 | 262 | 78.9 |
13C chemical shifts | 244 | 205 | 84.0 |
15N chemical shifts | 59 | 51 | 86.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 113 | 108 | 95.6 |
13C chemical shifts | 112 | 106 | 94.6 |
15N chemical shifts | 51 | 50 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 219 | 154 | 70.3 |
13C chemical shifts | 132 | 99 | 75.0 |
15N chemical shifts | 8 | 1 | 12.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 12 | 80.0 |
13C chemical shifts | 15 | 11 | 73.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 34 | 17 | 50.0 |
13C chemical shifts | 32 | 4 | 12.5 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50------ MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK |||||||||||||||||||||||||||||||||||||||||||||||||||||||| MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK
Dihedral angle restraints
--------10--------20--------30--------40--------50------ MTAYRCPVCDYTYDEGKGDPREGFPAGTRWDQIPDDWCCPDCSVREKVDFERMGGK |||||||||||||||||| |||||||||||||||||||||||||||||||||| MTAYRCPVCDYTYDEGKG.PREGFPAGTRWDQIPDDWCCPDCSVREKVDFERM --------10--------20--------30--------40--------50---