1H, 13C and 15N backbone and side-chain resonance assignments of the N-terminal ubiquitin-binding domain of the human deubiquitinase USP28
GSMTAELQQD DAAGAADGHG SSCQMLLNQL REITGIQDPS FLHEALKASN GDITQAVSLL TDERVKEPSQ DTVATEPSEV EGSAANKEVL AKVIDLTHDN KDDLQAAIAL SLLESPKIQA DGVDKLAAAL EHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.9 % (1233 of 1469) | 83.1 % (626 of 753) | 86.3 % (492 of 570) | 78.8 % (115 of 146) |
Backbone | 87.2 % (710 of 814) | 86.0 % (239 of 278) | 88.6 % (357 of 403) | 85.7 % (114 of 133) |
Sidechain | 80.2 % (629 of 784) | 80.6 % (383 of 475) | 82.8 % (245 of 296) | 7.7 % (1 of 13) |
Aromatic | 0.0 % (0 of 46) | 0.0 % (0 of 23) | 0.0 % (0 of 23) | |
Methyl | 89.9 % (151 of 168) | 90.5 % (76 of 84) | 89.3 % (75 of 84) |
1. USP28
GSMTAELQQD DAAGAADGHG SSCQMLLNQL REITGIQDPS FLHEALKASN GDITQAVSLL TDERVKEPSQ DTVATEPSEV EGSAANKEVL AKVIDLTHDN KDDLQAAIAL SLLESPKIQA DGVDKLAAAL EHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D20 | natural abundance | 10 % | |
2 | H20 | natural abundance | 90 % | |
3 | USP-28 | [U-15N] | 0.8 ~ 1.0 mM | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM | |
6 | DTT | natural abundance | 2 mM | |
7 | NaNH3 | natural abundance | 0.02 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | D20 | natural abundance | 100 % | |
16 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
17 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
18 | NaCl | natural abundance | 100 mM | |
19 | DTT | natural abundance | 2 mM | |
20 | NaNH3 | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 na | na | indirect | 0.251 |
1H | water | protons | 4.77 na | internal | direct | 1.0 |
15N | water | protons | 0.0 na | na | indirect | 0.101 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 na | na | indirect | 0.251 |
1H | water | protons | 4.77 na | internal | direct | 1.0 |
15N | water | protons | 0.0 na | na | indirect | 0.101 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 na | na | indirect | 0.251 |
1H | water | protons | 4.77 na | internal | direct | 1.0 |
15N | water | protons | 0.0 na | na | indirect | 0.101 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 0.0 na | na | indirect | 0.251 |
1H | water | protons | 4.77 na | internal | direct | 1.0 |
15N | water | protons | 0.0 na | na | indirect | 0.101 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D20 | natural abundance | 10 % | |
2 | H20 | natural abundance | 90 % | |
3 | USP-28 | [U-15N] | 0.8 ~ 1.0 mM | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM | |
6 | DTT | natural abundance | 2 mM | |
7 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | D20 | natural abundance | 100 % | |
16 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
17 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
18 | NaCl | natural abundance | 100 mM | |
19 | DTT | natural abundance | 2 mM | |
20 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | D20 | natural abundance | 10 % | |
9 | H20 | natural abundance | 90 % | |
10 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
11 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
12 | NaCl | natural abundance | 100 mM | |
13 | DTT | natural abundance | 2 mM | |
14 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | D20 | natural abundance | 100 % | |
16 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
17 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
18 | NaCl | natural abundance | 100 mM | |
19 | DTT | natural abundance | 2 mM | |
20 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | D20 | natural abundance | 10 % | |
2 | H20 | natural abundance | 90 % | |
3 | USP-28 | [U-15N] | 0.8 ~ 1.0 mM | |
4 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
5 | NaCl | natural abundance | 100 mM | |
6 | DTT | natural abundance | 2 mM | |
7 | NaNH3 | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298.2 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | D20 | natural abundance | 100 % | |
16 | USP-28 | [U-15N; U-13C] | 0.8 ~ 1.0 mM | |
17 | Na2HPO4/NaH2PO4 | natural abundance | 20 mM | |
18 | NaCl | natural abundance | 100 mM | |
19 | DTT | natural abundance | 2 mM | |
20 | NaNH3 | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19077_2muu.nef |
Input source #2: Coordindates | 2muu.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDN --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110-------120-------130----- KDDLQAAIALSLLESPKIQADGVDKLAAALEHHHHHH ||||||||||||||||||||||||||||||||||||| KDDLQAAIALSLLESPKIQADGVDKLAAALEHHHHHH -------110-------120-------130-------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 137 | 0 | 0 | 100.0 |
Content subtype: combined_19077_2muu.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SMTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDN -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130----- KDDLQAAIALSLLESPKIQADGVDKLAAALEHHHHHH ||||||||||||||||||||||| KDDLQAAIALSLLESPKIQADGV 00-------110-------120-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 570 | 487 | 85.4 |
1H chemical shifts | 753 | 614 | 81.5 |
15N chemical shifts | 148 | 111 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 274 | 243 | 88.7 |
1H chemical shifts | 278 | 238 | 85.6 |
15N chemical shifts | 133 | 111 | 83.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 296 | 244 | 82.4 |
1H chemical shifts | 475 | 376 | 79.2 |
15N chemical shifts | 15 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 86 | 75 | 87.2 |
1H chemical shifts | 86 | 75 | 87.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 23 | 0 | 0.0 |
1H chemical shifts | 23 | 0 | 0.0 |
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 GSMTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDN -0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 00-------110-------120-------130----- KDDLQAAIALSLLESPKIQADGVDKLAAALEHHHHHH ||||||||||||||||||||||| KDDLQAAIALSLLESPKIQADGV 00-------110-------120-
Dihedral angle restraints