Solution structure of the 2A proteinase from a common cold agent, human rhinovirus RV-C02, strain W12
GPSDLFVHTE QAIYKNAHLT TPNDQTILLA LTADLQIDGC DQPGPDNIPD CDCTSGCYYS RSLDRYIPVE CEAHDWYPVE ETQYYPKHIQ YNLLIGEGPC VPGDAGGKLL CRHGVIGIIT AGGDGHVAFT DLRPYNIKAT SQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.2 % (1343 of 1576) | 85.3 % (692 of 811) | 84.1 % (522 of 621) | 89.6 % (129 of 144) |
Backbone | 94.2 % (782 of 830) | 95.8 % (275 of 287) | 92.5 % (381 of 412) | 96.2 % (126 of 131) |
Sidechain | 78.5 % (686 of 874) | 79.6 % (417 of 524) | 78.9 % (266 of 337) | 23.1 % (3 of 13) |
Aromatic | 10.9 % (14 of 128) | 18.8 % (12 of 64) | 3.2 % (2 of 63) | 0.0 % (0 of 1) |
Methyl | 96.8 % (149 of 154) | 97.4 % (75 of 77) | 96.1 % (74 of 77) |
1. 2A proteinase
GPSDLFVHTE QAIYKNAHLT TPNDQTILLA LTADLQIDGC DQPGPDNIPD CDCTSGCYYS RSLDRYIPVE CEAHDWYPVE ETQYYPKHIQ YNLLIGEGPC VPGDAGGKLL CRHGVIGIIT AGGDGHVAFT DLRPYNIKAT SQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | direct | 1.0 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | direct | 1.0 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | direct | 1.0 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | carbons | 0.0 ppm | internal | direct | 1.0 |
1H | water | protons | 0.0 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 0.0 ppm | internal | direct | 1.0 |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Varian VNMRS - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MES | natural abundance | 10 mM | |
2 | sodium chloride | natural abundance | 20 mM | |
3 | DTT | natural abundance | 10 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % | |
6 | 2A_proteinase | natural abundance | 0.0 ~ 0.0 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19079_2m5t.nef |
Input source #2: Coordindates | 2m5t.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:113:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:53:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:51:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:111:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | Distance restraints |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQYYPKHIQYNLLIGEGPC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQYYPKHIQYNLLIGEGPC -------110-------120-------130-------140-- VPGDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ |||||||||||||||||||||||||||||||||||||||||| VPGDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_19079_2m5t.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQYYPKHIQYNLLIGEGPC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||| GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQY.PKHIQYNLLIGEGPC -------110-------120-------130-------140-- VPGDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ | |||||||||||||||||||||||||||||||||||||||| V.GDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
3 | SER | HG | 6.408 |
20 | THR | HG1 | 4.204 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 811 | 690 | 85.1 |
13C chemical shifts | 621 | 515 | 82.9 |
15N chemical shifts | 148 | 125 | 84.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 287 | 278 | 96.9 |
13C chemical shifts | 284 | 253 | 89.1 |
15N chemical shifts | 131 | 125 | 95.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 524 | 412 | 78.6 |
13C chemical shifts | 337 | 262 | 77.7 |
15N chemical shifts | 17 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 77 | 76 | 98.7 |
13C chemical shifts | 77 | 73 | 94.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 5 | 7.8 |
13C chemical shifts | 63 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQYYPKHIQYNLLIGEGPC |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| | ||||||||||||||| ..SDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEET.Y.PKHIQYNLLIGEGPC --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-- VPGDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ | |||||||||||||||||||||||||||||||||||| V..DAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKA -------110-------120-------130---------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GPSDLFVHTEQAIYKNAHLTTPNDQTILLALTADLQIDGCDQPGPDNIPDCDCTSGCYYSRSLDRYIPVECEAHDWYPVEETQYYPKHIQYNLLIGEGPC ||||||||||||||| ||||||||||||||||||| ||||||||||||||||||||||||||| ||||||||||| .....FVHTEQAIYKNAHLT......ILLALTADLQIDGCDQPGP........TSGCYYSRSLDRYIPVECEAHDWYPVE.......HIQYNLLIGEG.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-- VPGDAGGKLLCRHGVIGIITAGGDGHVAFTDLRPYNIKATSQ |||||| |||||||||| ||||||| .....GGKLLC..GVIGIITAGG.GHVAFTD -------110-------120-------130-