NMR solution structure ensemble of 3-4D mutant domain 11 IGF2R in complex with IGF2 (domain 11 structure only)
MKSNEHDDCQ VTNPSTGHLF DLSSLSGRAG FTAAYAKGWG VYMSICGENE NCPPGVGACF GQTRISVGKA NKRLRYVDQV LQLVYKDGSP CPSKSGLSYK SVISFVCRPE AGPTNRPMLI SLDKQTCTLF FSWHTPLACE LA
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS9:SG | 1:CYS46:SG |
2 | disulfide | sing | 1:CYS52:SG | 1:CYS59:SG |
3 | disulfide | sing | 1:CYS91:SG | 1:CYS127:SG |
4 | disulfide | sing | 1:CYS107:SG | 1:CYS139:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.5 % (1492 of 1596) | 94.6 % (782 of 827) | 90.9 % (566 of 623) | 98.6 % (144 of 146) |
Backbone | 98.0 % (817 of 834) | 98.6 % (284 of 288) | 97.1 % (401 of 413) | 99.2 % (132 of 133) |
Sidechain | 90.0 % (802 of 891) | 92.4 % (498 of 539) | 86.1 % (292 of 339) | 92.3 % (12 of 13) |
Aromatic | 62.5 % (85 of 136) | 80.9 % (55 of 68) | 42.4 % (28 of 66) | 100.0 % (2 of 2) |
Methyl | 98.5 % (132 of 134) | 97.0 % (65 of 67) | 100.0 % (67 of 67) |
1. Domain 11
MKSNEHDDCQ VTNPSTGHLF DLSSLSGRAG FTAAYAKGWG VYMSICGENE NCPPGVGACF GQTRISVGKA NKRLRYVDQV LQLVYKDGSP CPSKSGLSYK SVISFVCRPE AGPTNRPMLI SLDKQTCTLF FSWHTPLACE LASolvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Temperature 298.15 K, pH 4
Temperature 298.15 K, pH 4
Temperature 298.15 K, pH 4
Temperature 298.15 K, pH 4
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 298.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | Domain_11 | natural abundance | 1 mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian VNMRS - 900 MHz Fitted with a cryogenically cooled probehead. HWB-NMR/Welcome Trust.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian VNMRS - 900 MHz Fitted with a cryogenically cooled probehead. HWB-NMR/Welcome Trust.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Varian VNMRS - 900 MHz Fitted with a cryogenically cooled probehead. HWB-NMR/Welcome Trust.
State isotropic, Solvent system 93% H2O/7% D2O, Temperature 310.15 K, pH 4, Details STRUCTURAL STUDIES: Lyophilised IGF2 was added to solution state domain 11 at pH 4 in a 1:1 ratio.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Domain_11 | natural abundance | 1 mM | |
2 | H2O | natural abundance | 93 % | |
3 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19117_2m68.nef |
Input source #2: Coordindates | 2m68.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:1516:CYS:SG | A:1553:CYS:SG | oxidized, CA 58.543, CB 41.645 ppm | oxidized, CA 57.157, CB 41.785 ppm | 2.011 |
A:1559:CYS:SG | A:1566:CYS:SG | unknown, CA 51.191 ppm | oxidized, CA 56.911, CB 43.947 ppm | 2.028 |
A:1598:CYS:SG | A:1634:CYS:SG | unknown, CA 52.629 ppm | oxidized, CA 58.071, CB 41.759 ppm | 2.033 |
A:1614:CYS:SG | A:1646:CYS:SG | oxidized, CA 57.662, CB 39.415 ppm | oxidized, CA 54.822, CB 43.25 ppm | 2.032 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||||||||||||||||||||||||||||||||||| SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA -------110-------120-------130-------140--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_19117_2m68.nef
Assigned chemical shifts
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK |||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENC.PGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||||||||||||||||||||||||||||||||||| SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1573 | SER | HG | 5.664 |
1592 | TYR | HH | 9.901 |
1642 | THR | HG1 | 6.535 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 827 | 789 | 95.4 |
13C chemical shifts | 623 | 558 | 89.6 |
15N chemical shifts | 152 | 150 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 288 | 286 | 99.3 |
13C chemical shifts | 284 | 271 | 95.4 |
15N chemical shifts | 133 | 132 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 503 | 93.3 |
13C chemical shifts | 339 | 287 | 84.7 |
15N chemical shifts | 19 | 18 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 70 | 100.0 |
13C chemical shifts | 70 | 70 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 55 | 80.9 |
13C chemical shifts | 66 | 24 | 36.4 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK |||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENC.PGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||||||||||||||||||||||||||||||||||| SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA