apo_YqcA
MAEIGIFVGT MYGNSLLVAE EAEAILTAQG HKATVFEDPE LSDWLPYQDK YVLVVTSTTG QGDLPDSIVP LFQGIKDSLG FQPNLRYGVI ALGDSSYVNF CNGGKQFDAL LQEQSAQRVG EMLLIDASEN PEPETESNPW VEHWGTLLS
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.6 % (1498 of 1691) | 88.0 % (764 of 868) | 89.3 % (593 of 664) | 88.7 % (141 of 159) |
Backbone | 92.7 % (814 of 878) | 93.1 % (283 of 304) | 93.8 % (406 of 433) | 88.7 % (125 of 141) |
Sidechain | 85.7 % (812 of 948) | 85.3 % (481 of 564) | 86.1 % (315 of 366) | 88.9 % (16 of 18) |
Aromatic | 50.7 % (73 of 144) | 50.0 % (36 of 72) | 49.3 % (34 of 69) | 100.0 % (3 of 3) |
Methyl | 94.9 % (167 of 176) | 94.3 % (83 of 88) | 95.5 % (84 of 88) |
1. entity
MAEIGIFVGT MYGNSLLVAE EAEAILTAQG HKATVFEDPE LSDWLPYQDK YVLVVTSTTG QGDLPDSIVP LFQGIKDSLG FQPNLRYGVI ALGDSSYVNF CNGGKQFDAL LQEQSAQRVG EMLLIDASEN PEPETESNPW VEHWGTLLSSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | DTT | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 30 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | DTT | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 30 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | protein | [U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | DTT | natural abundance | 20 mM | |
4 | sodium chloride | natural abundance | 30 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | protein | [U-13C; U-15N] | 1 mM | |
8 | sodium phosphate | natural abundance | 30 mM | |
9 | DTT | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 30 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19151_2m6r.nef |
Input source #2: Coordindates | 2m6r.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNF -------110-------120-------130-------140--------- CNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS ||||||||||||||||||||||||||||||||||||||||||||||||| CNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 149 | 0 | 0 | 100.0 |
Content subtype: combined_19151_2m6r.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNF |||||||| || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AEIGIFVG..YG...LVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNF -------110-------120-------130-------140--------- CNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS ||||||||||||||||||||||||||||||||||||||||||||||||| CNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
108 | ASP | CG | 39.722 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 868 | 760 | 87.6 |
13C chemical shifts | 664 | 586 | 88.3 |
15N chemical shifts | 161 | 138 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 304 | 282 | 92.8 |
13C chemical shifts | 298 | 275 | 92.3 |
15N chemical shifts | 141 | 121 | 85.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 564 | 478 | 84.8 |
13C chemical shifts | 366 | 311 | 85.0 |
15N chemical shifts | 20 | 17 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 91 | 85 | 93.4 |
13C chemical shifts | 91 | 85 | 93.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 72 | 32 | 44.4 |
13C chemical shifts | 69 | 30 | 43.5 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAEIGIFVGTMYGNSLLVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTTGQGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNF |||||||| || ||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||| .AEIGIFVG..YG...LVAEEAEAILTAQGHKATVFEDPELSDWLPYQDKYVLVVTSTT.QGDLPDSIVPLFQGIKDSLGFQPNLRYGVIALGDSSYVNF -------110-------120-------130-------140--------- CNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS ||||||||||||||||||||||||||||||||||||||||||||||||| CNGGKQFDALLQEQSAQRVGEMLLIDASENPEPETESNPWVEHWGTLLS