NMR solution structure ensemble of 3-4D mutant domain 11 IGF2R
MKSNEHDDCQ VTNPSTGHLF DLSSLSGRAG FTAAYAKGWG VYMSICGENE NCPPGVGACF GQTRISVGKA NKRLRYVDQV LQLVYKDGSP CPSKSGLSYK SVISFVCRPE AGPTNRPMLI SLDKQTCTLF FSWHTPLACE LA
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS9:SG | 1:CYS46:SG |
2 | disulfide | sing | 1:CYS52:SG | 1:CYS59:SG |
3 | disulfide | sing | 1:CYS91:SG | 1:CYS127:SG |
4 | disulfide | sing | 1:CYS107:SG | 1:CYS139:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.4 % (1555 of 1596) | 98.1 % (811 of 827) | 96.1 % (599 of 623) | 99.3 % (145 of 146) |
Backbone | 98.8 % (824 of 834) | 99.7 % (287 of 288) | 98.1 % (405 of 413) | 99.2 % (132 of 133) |
Sidechain | 96.5 % (860 of 891) | 97.2 % (524 of 539) | 95.3 % (323 of 339) | 100.0 % (13 of 13) |
Aromatic | 86.0 % (117 of 136) | 95.6 % (65 of 68) | 75.8 % (50 of 66) | 100.0 % (2 of 2) |
Methyl | 100.0 % (134 of 134) | 100.0 % (67 of 67) | 100.0 % (67 of 67) |
1. IGF2R
MKSNEHDDCQ VTNPSTGHLF DLSSLSGRAG FTAAYAKGWG VYMSICGENE NCPPGVGACF GQTRISVGKA NKRLRYVDQV LQLVYKDGSP CPSKSGLSYK SVISFVCRPE AGPTNRPMLI SLDKQTCTLF FSWHTPLACE LASolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Pressure 1 atm, Temperature 273 K, pH 5.5
Experiment name T1 experiments
Pressure 1 atm, Temperature 273 K, pH 5.5
Experiment name T2 experiments
Pressure 1 atm, Temperature 273 K, pH 5.5
Experiment name Heteronuclear NOE ratio
Pressure 1 atm, Temperature 273 K, pH 5.5
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 900 MHz Fitted with a cryogenically cooled probehead. HWB-NMR/Welcome Trust.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 900 MHz Fitted with a cryogenically cooled probehead. HWB-NMR/Welcome Trust.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 900 MHz Fitted with a cryogenically cooled probehead. HWB-NMR/Welcome Trust.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details DYNAMICS STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | IGF2R | [U-95% 15N] | 1 mM | |
8 | D2O | [U-2H] | 7 % | |
9 | H2O | natural abundance | 93 % | |
10 | sodium azide | natural abundance | 100 uM | |
11 | EDTA | natural abundance | 1 mM | |
12 | sodium acetate | natural abundance | 10 mM |
Varian VNMRS - 600 MHz Fitted with a cryogenically cooled probehead. Bristol University.
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 5.5, Details STRUCTURAL STUDIES
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | IGF2R | [U-95% 13C; U-95% 15N] | 1 mM | |
2 | D2O | [U-2H] | 7 % | |
3 | H2O | natural abundance | 93 % | |
4 | sodium azide | natural abundance | 100 uM | |
5 | EDTA | natural abundance | 1 mM | |
6 | sodium acetate | natural abundance | 10 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19153_2m6t.nef |
Input source #2: Coordindates | 2m6t.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:1516:CYS:SG | A:1553:CYS:SG | oxidized, CA 58.373, CB 41.473 ppm | oxidized, CA 56.794, CB 41.432 ppm | 2.018 |
A:1559:CYS:SG | A:1566:CYS:SG | oxidized, CA 50.757, CB 39.39 ppm | oxidized, CA 55.785, CB 42.961 ppm | 2.02 |
A:1598:CYS:SG | A:1634:CYS:SG | oxidized, CA 52.203, CB 42.735 ppm | oxidized, CA 59.011, CB 40.718 ppm | 2.029 |
A:1614:CYS:SG | A:1646:CYS:SG | oxidized, CA 57.282, CB 39.003 ppm | oxidized, CA 54.518, CB 42.732 ppm | 2.025 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||||||||||||||||||||||||||||||||||| SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA -------110-------120-------130-------140--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_19153_2m6t.nef
Assigned chemical shifts
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||||||||||||||||||||||||||||||||||| SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
1513 | HIS | HE2 | 7.021 |
1522 | SER | HG | 5.191 |
1573 | SER | HG | 5.803 |
1592 | TYR | HH | 9.922 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 827 | 811 | 98.1 |
13C chemical shifts | 623 | 597 | 95.8 |
15N chemical shifts | 152 | 151 | 99.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 288 | 287 | 99.7 |
13C chemical shifts | 284 | 274 | 96.5 |
15N chemical shifts | 133 | 132 | 99.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 539 | 524 | 97.2 |
13C chemical shifts | 339 | 323 | 95.3 |
15N chemical shifts | 19 | 19 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 70 | 70 | 100.0 |
13C chemical shifts | 70 | 70 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 65 | 95.6 |
13C chemical shifts | 66 | 50 | 75.8 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK ||||| | |||||| | |||||||| | | ||||||||| ||| | | | || | ||||||| ||||||||| | || |||| .KSNEH.D.QVTNPS.G.LFDLSSLS....F.A.......VYMSICGEN.NCP..V.A.F.....SV.K.NKRLRYV.QVLQLVYKD...C.SK..LSYK --1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||| |||||| || || |||||| |||| | .VISFVCRPEA..TNRPML.SL.KQ..TLFFSW.TPLA.E 610------1620------1630------1640-------
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .KSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA |||||||||||||||||||||||||||||||||||||||||| SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA
Dihedral angle restraints
--1510---1520------1530------1540------1550------1560------1570------1580------1590------1600------1 MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYAKGWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYK |||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| ....EHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYA.GWGVYMSICGENENCPPGVGACFGQTRISVGKANKRLRYVDQVLQLVYK.GSPCPSKSGLSYK 610------1620------1630------1640--------- SVISFVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACELA ||||||||||| |||||||||||||||||||||||||||||| SVISFVCRPEA.PTNRPMLISLDKQTCTLFFSWHTPLACELA