Solution structure of uncharacterized thioredoxin-like protein PG_2175 from Porphyromonas gingivalis
MSLNTYAQLP AVSLKNIEGK TVQTNKLENA GKPMIISFFA TNCKPCLREL KAIQEVYADW QDETGVRLIA VSIDEGQNAQ KVKPLADGNG WEYEVLLDSN GDFKRAMNVS LIPAVFIVDG NGKIVYNHTG YTEGGEAELI KKVRELVKEG HHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.6 % (1698 of 1814) | 92.9 % (874 of 941) | 94.2 % (662 of 703) | 95.3 % (162 of 170) |
Backbone | 96.7 % (895 of 926) | 96.2 % (308 of 320) | 97.1 % (442 of 455) | 96.0 % (145 of 151) |
Sidechain | 91.4 % (942 of 1031) | 91.1 % (566 of 621) | 91.8 % (359 of 391) | 89.5 % (17 of 19) |
Aromatic | 80.3 % (106 of 132) | 80.3 % (53 of 66) | 79.7 % (51 of 64) | 100.0 % (2 of 2) |
Methyl | 100.0 % (182 of 182) | 100.0 % (91 of 91) | 100.0 % (91 of 91) |
1. PG 2175
MSLNTYAQLP AVSLKNIEGK TVQTNKLENA GKPMIISFFA TNCKPCLREL KAIQEVYADW QDETGVRLIA VSIDEGQNAQ KVKPLADGNG WEYEVLLDSN GDFKRAMNVS LIPAVFIVDG NGKIVYNHTG YTEGGEAELI KKVRELVKEG HHHHHHSolvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D20 | natural abundance | 100 % | |
9 | Na acetate buffer | natural abundance | 10 mM | |
10 | DTT | natural abundance | 3 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D20 | natural abundance | 100 % | |
9 | Na acetate buffer | natural abundance | 10 mM | |
10 | DTT | natural abundance | 3 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D20 | natural abundance | 100 % | |
9 | Na acetate buffer | natural abundance | 10 mM | |
10 | DTT | natural abundance | 3 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Bruker Avance - 700 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D20 | natural abundance | 100 % | |
9 | Na acetate buffer | natural abundance | 10 mM | |
10 | DTT | natural abundance | 3 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | D20 | natural abundance | 100 % | |
9 | Na acetate buffer | natural abundance | 10 mM | |
10 | DTT | natural abundance | 3 mM | |
11 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Varian Inova - 600 MHz
State isotropic, Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5, Details 10mM Na acetate buffer pH 4.5, 3mM DTT, 0.1mM EDTA
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PG_2175 | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | D20 | natural abundance | 10 % | |
3 | H20 | natural abundance | 90 % | |
4 | Na acetate buffer | natural abundance | 10 mM | |
5 | DTT | natural abundance | 3 mM | |
6 | EDTA | natural abundance | 0.1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19169_2m72.nef |
Input source #2: Coordindates | 2m72.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN -------110-------120-------130-------140-------150------ GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||| GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 156 | 0 | 0 | 100.0 |
Content subtype: combined_19169_2m72.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...NTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN -------110-------120-------130-------140-------150------ GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||| || GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGH...HH
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
4 | ASN | CG | 176.954 |
8 | GLN | CD | 180.573 |
16 | ASN | CG | 177.031 |
23 | GLN | CD | 180.248 |
24 | THR | HG1 | 5.551 |
25 | ASN | CG | 177.78 |
42 | ASN | CG | 178.445 |
48 | ARG | CZ | 160.105 |
54 | GLN | CD | 179.333 |
61 | GLN | CD | 181.188 |
67 | ARG | CZ | 160.306 |
78 | ASN | CG | 176.312 |
89 | ASN | CG | 177.51 |
100 | ASN | CG | 177.759 |
105 | ARG | CZ | 159.589 |
108 | ASN | CG | 178.292 |
121 | ASN | CG | 177.777 |
127 | ASN | CG | 176.256 |
144 | ARG | CZ | 159.421 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 941 | 859 | 91.3 |
13C chemical shifts | 703 | 651 | 92.6 |
15N chemical shifts | 174 | 163 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 320 | 305 | 95.3 |
13C chemical shifts | 312 | 300 | 96.2 |
15N chemical shifts | 151 | 143 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 621 | 554 | 89.2 |
13C chemical shifts | 391 | 351 | 89.8 |
15N chemical shifts | 23 | 20 | 87.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 91 | 96.8 |
13C chemical shifts | 94 | 91 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 66 | 51 | 77.3 |
13C chemical shifts | 64 | 49 | 76.6 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...NTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN -------110-------120-------130-------140-------150------ GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||| || GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGH...HH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MSLNTYAQLPAVSLKNIEGKTVQTNKLENAGKPMIISFFATNCKPCLRELKAIQEVYADWQDETGVRLIAVSIDEGQNAQKVKPLADGNGWEYEVLLDSN | ||||||| |||||| ||||||||||| |||||||||||||||| |||||||| ||||||||||||||| ||||||| .....Y....AVSLKNI.GKTVQT......GKPMIISFFAT......RELKAIQEVYADWQDE..VRLIAVSI..GQNAQKVKPLADGNG..YEVLLDS. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150------ GDFKRAMNVSLIPAVFIVDGNGKIVYNHTGYTEGGEAELIKKVRELVKEGHHHHHH ||||||| ||||||||| ||||||||| ||||||||||||||||| .DFKRAMN...IPAVFIVDG..KIVYNHTGY..GGEAELIKKVRELVKEG -------110-------120-------130-------140-------150