1H, 13C, and 15N Chemical Shift Assignments for the C-terminus of the minichromosome maintenance protein MCM from Methanothermobacter thermautotrophicus
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 97.8 % (1030 of 1053) | 97.3 % (541 of 556) | 98.8 % (405 of 410) | 96.6 % (84 of 87) |
Backbone | 98.3 % (513 of 522) | 97.8 % (177 of 181) | 98.8 % (253 of 256) | 97.6 % (83 of 85) |
Sidechain | 97.7 % (597 of 611) | 97.1 % (364 of 375) | 99.1 % (232 of 234) | 50.0 % (1 of 2) |
Aromatic | 92.3 % (48 of 52) | 92.3 % (24 of 26) | 92.3 % (24 of 26) | |
Methyl | 100.0 % (100 of 100) | 100.0 % (50 of 50) | 100.0 % (50 of 50) |
1. C-terminus MCM
GAMGETGKID IDKVEGRTPK SERDKFRLLL ELIKEYEDDY GGRAPTNILI TEMMDRYNVS EEKVEELIRI LKDKGAIFEP ARGYLKIVSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 10 mM | |
8 | sodium chloride | natural abundance | 150 mM | |
9 | D2O | natural abundance | 100 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker AvanceIII - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.2
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | C-terminus of the minichromosome maintenance protein MCM of Methanothermobacter thermautotrophicus | [U-13C; U-15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 150 mM | |
4 | H20 | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19187_2ma3.nef |
Input source #2: Coordindates | 2ma3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-580-----590-------600-------610-------620-------630-------640-------650-------660------ GAMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV --------10--------20--------30--------40--------50--------60--------70--------80--------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 88 | 0 | 0 | 100.0 |
Content subtype: combined_19187_2ma3.nef
Assigned chemical shifts
-580-----590-------600-------610-------620-------630-------640-------650-------660------ GAMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 556 | 539 | 96.9 |
13C chemical shifts | 410 | 405 | 98.8 |
15N chemical shifts | 94 | 83 | 88.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 181 | 177 | 97.8 |
13C chemical shifts | 176 | 173 | 98.3 |
15N chemical shifts | 85 | 83 | 97.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 375 | 362 | 96.5 |
13C chemical shifts | 234 | 232 | 99.1 |
15N chemical shifts | 9 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 53 | 53 | 100.0 |
13C chemical shifts | 53 | 53 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 26 | 24 | 92.3 |
13C chemical shifts | 26 | 24 | 92.3 |
Distance restraints
-580-----590-------600-------610-------620-------630-------640-------650-------660------ GAMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MG.TGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV
Dihedral angle restraints
-580-----590-------600-------610-------620-------630-------640-------650-------660------ GAMGETGKIDIDKVEGRTPKSERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNVSEEKVEELIRILKDKGAIFEPARGYLKIV |||||||||||||||||| |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||| ..MGETGKIDIDKVEGRTPK.ERDKFRLLLELIKEYEDDYGGRAPTNILITEMMDRYNV.EEKVEELIRILKDKGAIFEPARGYLKIV