Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1
GHMQTEEYVL SPLFDLPASK EDLMQQLQVQ KAMLESTEYV PGSTSMKGII RVLNISFEKL VYVRMSLDDW QTHYDILAEY VPNSCDGETD QFSFKISLVP PYQKDGSKVE FCIRYETSVG TFWSNNNGTN YTLVCQKKE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.0 % (1408 of 1657) | 95.8 % (825 of 861) | 68.1 % (440 of 646) | 95.3 % (143 of 150) |
Backbone | 82.4 % (677 of 822) | 96.8 % (270 of 279) | 68.0 % (279 of 410) | 96.2 % (128 of 133) |
Sidechain | 87.8 % (849 of 967) | 94.0 % (547 of 582) | 78.0 % (287 of 368) | 88.2 % (15 of 17) |
Aromatic | 43.6 % (68 of 156) | 79.5 % (62 of 78) | 5.3 % (4 of 76) | 100.0 % (2 of 2) |
Methyl | 100.0 % (140 of 140) | 100.0 % (70 of 70) | 100.0 % (70 of 70) |
1. GM CBM21
GHMQTEEYVL SPLFDLPASK EDLMQQLQVQ KAMLESTEYV PGSTSMKGII RVLNISFEKL VYVRMSLDDW QTHYDILAEY VPNSCDGETD QFSFKISLVP PYQKDGSKVE FCIRYETSVG TFWSNNNGTN YTLVCQKKESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GM_CBM21 | [U-99% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | GM_CBM21 | natural abundance | 0.8 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | DTT | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GM_CBM21 | [U-99% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | GM_CBM21 | natural abundance | 0.8 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | DTT | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | GM_CBM21 | natural abundance | 0.8 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | DTT | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | GM_CBM21 | natural abundance | 0.8 mM | |
14 | sodium phosphate | natural abundance | 20 mM | |
15 | sodium chloride | natural abundance | 50 mM | |
16 | DTT | natural abundance | 10 mM | |
17 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | GM_CBM21 | [U-99% 15N] | 0.8 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | DTT | natural abundance | 10 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | GM_CBM21 | [U-99% 13C; U-99% 15N] | 0.8 mM | |
8 | sodium phosphate | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | DTT | natural abundance | 10 mM | |
11 | H2O | natural abundance | 90 % | |
12 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19225_2m83.nef |
Input source #2: Coordindates | 2m83.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------2 GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVP --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------210-------220-------230------- PYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE ||||||||||||||||||||||||||||||||||||||| PYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE -------110-------120-------130---------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 139 | 0 | 0 | 100.0 |
Content subtype: combined_19225_2m83.nef
Assigned chemical shifts
-100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------2 GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVP |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..MQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVP 00-------210-------220-------230------- PYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE ||||||||||||||||||||||||||||||||||||||| PYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 861 | 818 | 95.0 |
13C chemical shifts | 646 | 422 | 65.3 |
15N chemical shifts | 153 | 144 | 94.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 279 | 271 | 97.1 |
13C chemical shifts | 278 | 137 | 49.3 |
15N chemical shifts | 133 | 128 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 582 | 547 | 94.0 |
13C chemical shifts | 368 | 285 | 77.4 |
15N chemical shifts | 20 | 16 | 80.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 75 | 70 | 93.3 |
13C chemical shifts | 75 | 70 | 93.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 57 | 73.1 |
13C chemical shifts | 76 | 0 | 0.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-100-----110-------120-------130-------140-------150-------160-------170-------180-------190-------2 GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...QTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVP 00-------210-------220-------230------- PYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE ||||||||||||||||||||||||||||||||||||||| PYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTLVCQKKE