Solution structure of the Dictyostelium discodieum Myosin Light Chain, MlcC
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.4 % (846 of 906) | 94.2 % (440 of 467) | 91.5 % (325 of 355) | 96.4 % (81 of 84) |
Backbone | 95.6 % (438 of 458) | 96.2 % (152 of 158) | 95.1 % (214 of 225) | 96.0 % (72 of 75) |
Sidechain | 92.3 % (479 of 519) | 93.2 % (288 of 309) | 90.5 % (182 of 201) | 100.0 % (9 of 9) |
Aromatic | 72.0 % (72 of 100) | 72.0 % (36 of 50) | 71.4 % (35 of 49) | 100.0 % (1 of 1) |
Methyl | 100.0 % (78 of 78) | 100.0 % (39 of 39) | 100.0 % (39 of 39) |
1. entity
GSHMNHINTK AQVIEAFKVF DRDGNGYVTV DYLRKVLNEL GDMMPADEIE EMIYEADPQN SGYVQYETFV GMLFLWDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
1H | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | direct | 1.0 |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Varian INOVA - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | natural abundance | 1 mM | |
2 | HEPES | natural abundance | 10 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | D2O | [U-100% 2H] | 10 % | |
5 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19274_2m8u.nef |
Input source #2: Coordindates | 2m8u.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70------- GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 77 | 0 | 0 | 100.0 |
Content subtype: combined_19274_2m8u.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70------- GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..HMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 467 | 431 | 92.3 |
13C chemical shifts | 355 | 320 | 90.1 |
15N chemical shifts | 86 | 81 | 94.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 158 | 148 | 93.7 |
13C chemical shifts | 154 | 140 | 90.9 |
15N chemical shifts | 75 | 71 | 94.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 309 | 283 | 91.6 |
13C chemical shifts | 201 | 180 | 89.6 |
15N chemical shifts | 11 | 10 | 90.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 44 | 39 | 88.6 |
13C chemical shifts | 44 | 39 | 88.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 50 | 36 | 72.0 |
13C chemical shifts | 49 | 35 | 71.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70------- GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....HINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70------- GSHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ........TKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLW --------10--------20--------30--------40--------50--------60--------70------