Analysis of target DNA binding sites through NMR structural analysis of the MLV IN CTD and homology modeling of the CCD domains.
MGHHHHHHSH MVGDTVWVRR HQTKNLEPRW KGPYTVLLTT PTALKVDGIA AWIHAAHVKA ADPGGGPSSR LTWRVQRSQN PLKIRLTREA P
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.9 % (836 of 1060) | 75.7 % (417 of 551) | 82.5 % (343 of 416) | 81.7 % (76 of 93) |
Backbone | 86.8 % (462 of 532) | 85.2 % (155 of 182) | 88.3 % (235 of 266) | 85.7 % (72 of 84) |
Sidechain | 73.4 % (449 of 612) | 71.0 % (262 of 369) | 78.2 % (183 of 234) | 44.4 % (4 of 9) |
Aromatic | 60.4 % (58 of 96) | 60.4 % (29 of 48) | 56.8 % (25 of 44) | 100.0 % (4 of 4) |
Methyl | 98.0 % (98 of 100) | 98.0 % (49 of 50) | 98.0 % (49 of 50) |
1. OR41A-15.1
MGHHHHHHSH MVGDTVWVRR HQTKNLEPRW KGPYTVLLTT PTALKVDGIA AWIHAAHVKA ADPGGGPSSR LTWRVQRSQN PLKIRLTREA PSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | MLV IN CTD | [U-10% 13C; U-100% 15N] | 0.5 mM | |
7 | NaCl | natural abundance | 100 mM | |
8 | potassium glutamate | natural abundance | 50 mM | |
9 | MES | natural abundance | 20 mM | |
10 | DSS | natural abundance | 50 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | external | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | external | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MLV IN CTD | [U-100% 13C; U-100% 15N] | 0.5 mM | |
2 | NaCl | natural abundance | 100 mM | |
3 | potassium glutamate | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | MLV IN CTD | [U-10% 13C; U-100% 15N] | 0.5 mM | |
7 | NaCl | natural abundance | 100 mM | |
8 | potassium glutamate | natural abundance | 50 mM | |
9 | MES | natural abundance | 20 mM | |
10 | DSS | natural abundance | 50 uM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.5mM OR41A-15.1, 10% D2O, 50 uM DSS, 100 mM NaCl, 50 mM potassium glutamate, 20 mM MES pH 6.5.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | MLV IN CTD | [U-10% 13C; U-100% 15N] | 0.5 mM | |
7 | NaCl | natural abundance | 100 mM | |
8 | potassium glutamate | natural abundance | 50 mM | |
9 | MES | natural abundance | 20 mM | |
10 | DSS | natural abundance | 50 uM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19299_2m9u.nef |
Input source #2: Coordindates | 2m9u.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------- HHHHHHSHMVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| HHHHHHSHMVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 89 | 0 | 0 | 100.0 |
Content subtype: combined_19299_2m9u.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------- HHHHHHSHMVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP ||||||||||||| || |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....HHSHMVGDTVWVR.HQ.KNLE..WKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREA --------10--------20--------30--------40--------50--------60--------70--------80--------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 541 | 396 | 73.2 |
13C chemical shifts | 409 | 334 | 81.7 |
15N chemical shifts | 99 | 74 | 74.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 177 | 151 | 85.3 |
13C chemical shifts | 178 | 158 | 88.8 |
15N chemical shifts | 82 | 70 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 364 | 245 | 67.3 |
13C chemical shifts | 231 | 176 | 76.2 |
15N chemical shifts | 17 | 4 | 23.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 51 | 48 | 94.1 |
13C chemical shifts | 51 | 50 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 48 | 28 | 58.3 |
13C chemical shifts | 44 | 24 | 54.5 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------- HHHHHHSHMVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP |||||||||||| || ||||||||||| ||||||||||||||||||||| || ||||||| ||||||||||| .....HSHMVGDTVWVR.HQ.......WKGPYTVLLTT.TALKVDGIAAWIHAAHVKAAD...GP...LTWRVQR..NPLKIRLTREA --------10--------20--------30--------40--------50--------60--------70--------80--------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------- HHHHHHSHMVGDTVWVRRHQTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPGGGPSSRLTWRVQRSQNPLKIRLTREAP ||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| | | | ||| | .....HSHMVGDTVWVRR.QTKNLEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAADPG......L..R.......L.IRL.R --------10--------20--------30--------40--------50--------60--------70--------80------