Solution Structure of ERCC4 domain of human FAAP24
MEKNPPDDTG PVHVPLGHIV ANEKWRGSQL AQEMQGKIKL IFEDGLTPDF YLSNRCCILY VTEADLVAGN GYRKRLVRVR NSNNLKGIVV VEKTRMSEQY FPALQKFTVL DLGMVLLPVA SQMEASCLVI QLVQEQTKEL EHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.7 % (1428 of 1747) | 80.2 % (731 of 911) | 82.9 % (563 of 679) | 85.4 % (134 of 157) |
Backbone | 93.8 % (814 of 868) | 92.9 % (275 of 296) | 94.2 % (407 of 432) | 94.3 % (132 of 140) |
Sidechain | 72.8 % (740 of 1017) | 73.8 % (454 of 615) | 73.8 % (284 of 385) | 11.8 % (2 of 17) |
Aromatic | 18.1 % (21 of 116) | 34.5 % (20 of 58) | 0.0 % (0 of 57) | 100.0 % (1 of 1) |
Methyl | 93.8 % (167 of 178) | 94.4 % (84 of 89) | 93.3 % (83 of 89) |
1. FAAP24-ERCC4
MEKNPPDDTG PVHVPLGHIV ANEKWRGSQL AQEMQGKIKL IFEDGLTPDF YLSNRCCILY VTEADLVAGN GYRKRLVRVR NSNNLKGIVV VEKTRMSEQY FPALQKFTVL DLGMVLLPVA SQMEASCLVI QLVQEQTKEL EHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker Avance - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24-ERCC4 | [U-100% 13C; U-100% 15N] | 0.5 ~ 0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19302_2m9m.nef |
Input source #2: Coordindates | 2m9m.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQY -------110-------120-------130-------140------- FPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKELEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||| FPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKELEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 147 | 0 | 0 | 100.0 |
Content subtype: combined_19302_2m9m.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQY |||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MEKN.PDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140------- FPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKELEHHHHHH ||||||||||||||||||||||||||||||||||||||| FPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKE -------110-------120-------130---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 911 | 707 | 77.6 |
13C chemical shifts | 679 | 542 | 79.8 |
15N chemical shifts | 164 | 131 | 79.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 296 | 274 | 92.6 |
13C chemical shifts | 294 | 274 | 93.2 |
15N chemical shifts | 140 | 130 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 615 | 433 | 70.4 |
13C chemical shifts | 385 | 268 | 69.6 |
15N chemical shifts | 24 | 1 | 4.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 94 | 80 | 85.1 |
13C chemical shifts | 94 | 79 | 84.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 20 | 34.5 |
13C chemical shifts | 57 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .....PDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140------- FPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKELEHHHHHH |||||||||||||||||||||||||||||||||||||| FPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTK -------110-------120-------130--------