Solution Structure of (HhH)2 domain of human FAAP24
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 79.6 % (591 of 742) | 85.9 % (334 of 389) | 70.4 % (200 of 284) | 82.6 % (57 of 69) |
Backbone | 79.6 % (293 of 368) | 92.9 % (117 of 126) | 65.2 % (120 of 184) | 96.6 % (56 of 58) |
Sidechain | 82.2 % (355 of 432) | 82.5 % (217 of 263) | 86.7 % (137 of 158) | 9.1 % (1 of 11) |
Aromatic | 44.1 % (15 of 34) | 88.2 % (15 of 17) | 0.0 % (0 of 17) | |
Methyl | 100.0 % (82 of 82) | 100.0 % (41 of 41) | 100.0 % (41 of 41) |
1. FAAP24 HhH2
GSSEPSLLRT VQQIPGVGKV KAPLLLQKFP SIQQLSNASI GELEQVVGQA VAQQIHAFFT QPRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
2 | potassium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | beta-mercaptoethanol | natural abundance | 1 mM | |
5 | EDTA | natural abundance | 0.5 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Bruker DMX - 850 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | FAAP24_HhH2 | [U-100% 13C; U-100% 15N] | 0.5-0.8 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | beta-mercaptoethanol | natural abundance | 1 mM | |
12 | EDTA | natural abundance | 0.5 mM | |
13 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19303_2m9n.nef |
Input source #2: Coordindates | 2m9n.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----160-------170-------180-------190-------200-------210----- GSSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR --------10--------20--------30--------40--------50--------60---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 63 | 0 | 0 | 100.0 |
Content subtype: combined_19303_2m9n.nef
Assigned chemical shifts
-----160-------170-------180-------190-------200-------210----- GSSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 389 | 333 | 85.6 |
13C chemical shifts | 284 | 196 | 69.0 |
15N chemical shifts | 71 | 56 | 78.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 126 | 119 | 94.4 |
13C chemical shifts | 126 | 61 | 48.4 |
15N chemical shifts | 58 | 56 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 263 | 214 | 81.4 |
13C chemical shifts | 158 | 135 | 85.4 |
15N chemical shifts | 13 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 41 | 41 | 100.0 |
13C chemical shifts | 41 | 41 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 17 | 15 | 88.2 |
13C chemical shifts | 17 | 0 | 0.0 |
Distance restraints
-----160-------170-------180-------190-------200-------210----- GSSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ....PSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
Dihedral angle restraints
-----160-------170-------180-------190-------200-------210----- GSSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..SEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQP -----160-------170-------180-------190-------200-------210----