Solution NMR Structure of Transcription Factor GATA-4 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR4783B
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | covalent | sing | 1:CYS13:SG | 2:ZN1:ZN |
2 | covalent | sing | 1:CYS16:SG | 2:ZN1:ZN |
3 | covalent | sing | 1:CYS34:SG | 2:ZN1:ZN |
4 | covalent | sing | 1:CYS37:SG | 2:ZN1:ZN |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.1 % (639 of 717) | 86.0 % (326 of 379) | 93.0 % (253 of 272) | 90.9 % (60 of 66) |
Backbone | 91.9 % (342 of 372) | 90.6 % (116 of 128) | 93.5 % (172 of 184) | 90.0 % (54 of 60) |
Sidechain | 87.3 % (352 of 403) | 83.7 % (210 of 251) | 93.2 % (136 of 146) | 100.0 % (6 of 6) |
Aromatic | 100.0 % (28 of 28) | 100.0 % (14 of 14) | 100.0 % (13 of 13) | 100.0 % (1 of 1) |
Methyl | 100.0 % (58 of 58) | 100.0 % (29 of 29) | 100.0 % (29 of 29) |
1. HR4783B
SHMSASRRVG LSCANCQTTT TTLWRRNAEG EPVCNACGLY MKLHGVPRPL AMRKEGIQTR KRKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.156 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | HR4783B.009 | [U-5% 13C; U-100% 15N] | 0.156 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | Tris-HCl | natural abundance | 10 mM | |
14 | DSS | natural abundance | 50 uM | |
15 | sodium azide | natural abundance | 0..02 % | |
16 | ZINC ION | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.378 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR4783B.009 | [U-100% 13C; U-100% 15N] | 0.378 mM | |
2 | sodium chloride | natural abundance | 100 mM | |
3 | DTT | natural abundance | 5 mM | |
4 | Tris-HCl | natural abundance | 10 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0..02 % | |
7 | ZINC ION | natural abundance | 50 uM | |
8 | H2O | natural abundance | 90 % | |
9 | D2O | natural abundance | 10 % |
Varian INOVA - 750 MHz HCN,cold probe.
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 0.156 mM HR4783B, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | HR4783B.009 | [U-5% 13C; U-100% 15N] | 0.156 mM | |
11 | sodium chloride | natural abundance | 100 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | Tris-HCl | natural abundance | 10 mM | |
14 | DSS | natural abundance | 50 uM | |
15 | sodium azide | natural abundance | 0..02 % | |
16 | ZINC ION | natural abundance | 50 uM | |
17 | H2O | natural abundance | 90 % | |
18 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19312_2m9w.nef |
Input source #2: Coordindates | 2m9w.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:37:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:13:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:16:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:34:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--- SHMSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SHMSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 63 | 0 | 0 | 100.0 |
Content subtype: combined_19312_2m9w.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--- SHMSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .HM.ASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
2 | HIS | ND1 | 228.6 |
2 | HIS | NE2 | 178.943 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 379 | 331 | 87.3 |
13C chemical shifts | 272 | 253 | 93.0 |
15N chemical shifts | 74 | 60 | 81.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 128 | 118 | 92.2 |
13C chemical shifts | 126 | 117 | 92.9 |
15N chemical shifts | 60 | 54 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 251 | 213 | 84.9 |
13C chemical shifts | 146 | 136 | 93.2 |
15N chemical shifts | 14 | 6 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 32 | 100.0 |
13C chemical shifts | 32 | 32 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 14 | 100.0 |
13C chemical shifts | 13 | 13 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--- SHMSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRK ||||||||||||||||||||||||||||||||||||||||||| |||| |||| || .......RVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPL.MRKE.IQTR.RK
Dihedral angle restraints