Solution NMR Structure of Microtubule-associated serine/threonine-protein kinase 1 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR9151A
MGHHHHHHSH MPKATAQMEE KLRDFTRAYE PDSVLPLADG VLSFIHHQII ELARDCLTKS RDGLITTVYF YELQENLEKL LQDAYERSES LEVAFVTQLV KKLLIIISRP AR
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.8 % (1152 of 1343) | 85.8 % (598 of 697) | 85.5 % (455 of 532) | 86.8 % (99 of 114) |
Backbone | 84.9 % (564 of 664) | 84.8 % (189 of 223) | 84.7 % (282 of 333) | 86.1 % (93 of 108) |
Sidechain | 86.7 % (683 of 788) | 86.3 % (409 of 474) | 87.0 % (268 of 308) | 100.0 % (6 of 6) |
Aromatic | 63.0 % (68 of 108) | 63.0 % (34 of 54) | 63.0 % (34 of 54) | |
Methyl | 98.6 % (138 of 140) | 98.6 % (69 of 70) | 98.6 % (69 of 70) |
1. HR9151A
MGHHHHHHSH MPKATAQMEE KLRDFTRAYE PDSVLPLADG VLSFIHHQII ELARDCLTKS RDGLITTVYF YELQENLEKL LQDAYERSES LEVAFVTQLV KKLLIIISRP ARSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.388 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR9151A.011 | [%5-13C; U-100% 15N] | 0.39 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
11 | NaN3 | natural abundance | 0.02 % | |
12 | DSS | natural abundance | 50 uM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.508 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR9151A.011 | [U-100% 13C; U-100% 15N] | 0.508 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | DSS | natural abundance | 50 uM |
Varian INOVA - 750 MHz HCN,cold probe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 7.5, Details 0.388 mM HR9151A, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR9151A.011 | [%5-13C; U-100% 15N] | 0.39 mM | |
8 | DTT | natural abundance | 5 mM | |
9 | NaCl | natural abundance | 100 mM | |
10 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
11 | NaN3 | natural abundance | 0.02 % | |
12 | DSS | natural abundance | 50 uM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19314_2m9x.nef |
Input source #2: Coordindates | 2m9x.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV -------110-- KKLLIIISRPAR |||||||||||| KKLLIIISRPAR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 112 | 0 | 0 | 100.0 |
Content subtype: combined_19314_2m9x.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV || |||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| .........HM.KATAQMEEKLRDFTRAYEPDSVLPLA.GVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSE.LEVAFVTQLV -------110-- KKLLIIISRPAR |||||||||||| KKLLIIISRPAR
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
26 | THR | HG1 | 4.758 |
60 | SER | HG | 3.814 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 697 | 599 | 85.9 |
13C chemical shifts | 532 | 453 | 85.2 |
15N chemical shifts | 121 | 98 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 223 | 190 | 85.2 |
13C chemical shifts | 224 | 185 | 82.6 |
15N chemical shifts | 108 | 92 | 85.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 474 | 409 | 86.3 |
13C chemical shifts | 308 | 268 | 87.0 |
15N chemical shifts | 13 | 6 | 46.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 71 | 97.3 |
13C chemical shifts | 73 | 71 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 34 | 63.0 |
13C chemical shifts | 54 | 34 | 63.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV | ||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||| ..........M.KATAQMEEKLRDFTRAYEPDSVLPL...VLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYER...LEVAFVTQLV -------110-- KKLLIIISRPAR |||||||||||| KKLLIIISRPAR
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV |||||| | || | ||| | ||| ||||||| || |||| ||| ||| |||||||||||| || || | ||| ................QMEEKL.D.TR..E....LPL....L.FIH.QIIELAR.CL.KSRD.LIT.VYF.ELQENLEKLLQD.YE....LE...V.QLV -------110-- KKLLIIISRPAR ||||||| |||| KKLLIII.RPAR
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV ||||||||||||| |||||||||||||||||||| |||||||||||||||||| ||||||| ..............TAQMEEKLRDFTR.............VLSFIHHQIIELARDCLTKS.......VYFYELQENLEKLLQDAY........AFVTQLV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- KKLLIIISRPAR |||||| KKLLII ------
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV ||||||||||||| |||||||||||||||||||| |||||||||||||||||| ||||||| ..............TAQMEEKLRDFTR.............VLSFIHHQIIELARDCLTKS.......VYFYELQENLEKLLQDAY........AFVTQLV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- KKLLIIISRPAR |||||| KKLLII ------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMPKATAQMEEKLRDFTRAYEPDSVLPLADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAYERSESLEVAFVTQLV ||||||||||||||| |||||||||||||||||||||| |||||||||||||||||||| ||||||||| .............ATAQMEEKLRDFTRA...........GVLSFIHHQIIELARDCLTKSR.....TVYFYELQENLEKLLQDAYE.....EVAFVTQLV --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-- KKLLIIISRPAR ||||||| KKLLIII -------