Solution NMR Structure of Zinc finger protein Eos from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7992A
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 83.7 % (712 of 851) | 83.9 % (376 of 448) | 82.3 % (270 of 328) | 88.0 % (66 of 75) |
Backbone | 85.8 % (369 of 430) | 86.0 % (129 of 150) | 85.3 % (180 of 211) | 87.0 % (60 of 69) |
Sidechain | 82.1 % (399 of 486) | 82.9 % (247 of 298) | 80.2 % (146 of 182) | 100.0 % (6 of 6) |
Aromatic | 52.6 % (41 of 78) | 53.8 % (21 of 39) | 51.3 % (20 of 39) | |
Methyl | 100.0 % (50 of 50) | 100.0 % (25 of 25) | 100.0 % (25 of 25) |
1. HR7992A
MGHHHHHHSH MPNGKLKCDV CGMVCIGPNV LMVHKRSHTG ERPFHCNQCG ASFTQKGNLL RHIKLHSGEK PFKXSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details HR7992A.011
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR7992A.011 | [5% 13C; U-100% 15N] | 1 mM | |
9 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 100 mM | |
11 | NaN3 | natural abundance | 0.02 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | ZINC ION | natural abundance | 4 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details HR7992A.011
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | HR7992A.011 | [5% 13C; U-100% 15N] | 1 mM | |
9 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
10 | NaCl | natural abundance | 100 mM | |
11 | NaN3 | natural abundance | 0.02 mM | |
12 | DTT | natural abundance | 5 mM | |
13 | ZINC ION | natural abundance | 4 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.5, Details 1.0 mM HR7992A.010, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR7992A.010 | [U-100% 13C; U-100% 15N] | 1.0 mM | |
2 | DTT | natural abundance | 5 mM | |
3 | NaCl | natural abundance | 100 mM | |
4 | Tris-HCl pH 7.5 | natural abundance | 10 mM | |
5 | NaN3 | natural abundance | 0.02 % | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19331_2ma7.nef |
Input source #2: Coordindates | 2ma7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
1:66:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
1:48:GLN:O | 2:1:ZN:ZN | unknown | unknown | n/a |
1:49:CYS:SG | 2:1:ZN:ZN | unknown | unknown | n/a |
1:62:HIS:NE2 | 2:1:ZN:ZN | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | ZN | ZINC ION | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--- MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 73 | 0 | 0 | 100.0 |
Content subtype: combined_19331_2ma7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--- MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........PNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
25 | CYS | HG | 2.245 |
34 | HIS | ND1 | 170.425 |
34 | HIS | NE2 | 210.412 |
38 | HIS | NE2 | 213.967 |
45 | HIS | ND1 | 173.162 |
61 | ARG | NH1 | 84.729 |
62 | HIS | ND1 | 172.92 |
62 | HIS | NE2 | 216.641 |
66 | HIS | ND1 | 170.425 |
66 | HIS | NE2 | 211.644 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 448 | 374 | 83.5 |
13C chemical shifts | 328 | 265 | 80.8 |
15N chemical shifts | 78 | 67 | 85.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 150 | 127 | 84.7 |
13C chemical shifts | 146 | 120 | 82.2 |
15N chemical shifts | 69 | 58 | 84.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 298 | 247 | 82.9 |
13C chemical shifts | 182 | 145 | 79.7 |
15N chemical shifts | 9 | 9 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 29 | 25 | 86.2 |
13C chemical shifts | 29 | 25 | 86.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 39 | 21 | 53.8 |
13C chemical shifts | 39 | 20 | 51.3 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--- MGHHHHHHSHMPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFK |||| ||||||| |||||||||||| |||||| |||||||||||||||||||||||||| .............GKLK..VCGMVCI.PNVLMVHKRSHT.ERPFHC.QCGASFTQKGNLLRHIKLHSGEKPFK
Dihedral angle restraints