Solution structure of MBD3 methylcytosine binding domain while bound to hydroxymethylated DNA
Polymer type: polypeptide(L) polydeoxyribonucleotide
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 64.7 % (762 of 1178) | 49.3 % (382 of 775) | 94.0 % (312 of 332) | 95.8 % (68 of 71) |
Backbone | 62.2 % (402 of 646) | 36.7 % (136 of 371) | 97.1 % (202 of 208) | 95.5 % (64 of 67) |
Sidechain | 71.0 % (423 of 596) | 60.9 % (246 of 404) | 92.0 % (173 of 188) | 100.0 % (4 of 4) |
Aromatic | 50.0 % (78 of 156) | 37.3 % (41 of 110) | 79.5 % (35 of 44) | 100.0 % (2 of 2) |
Methyl | 86.7 % (39 of 45) | 79.2 % (19 of 24) | 95.2 % (20 of 21) |
1. MBD3
GSMERKRWEC PALPQGWERE EVPRRSGLSA GHRDVFYYSP SGKKFRSKPQ LARYLGGSMD LSTFDFRTGK ML2. hDNA A
GAGGCGCTXG GCGGCAG3. hDNA B
CTGCCGCXGA GCGCCTCSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | MBD3 | [U-99% 13C; U-99% 15N] | 0.5 ~ 1.0 mM | |
2 | hDNA_A | natural abundance | 0.6 ~ 1.1 mM | |
3 | hDNA_B | natural abundance | 0.6 ~ 1.1 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_19391_2mb7.nef |
Input source #2: Coordindates | 2mb7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70-- GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 72 | 0 | 0 | 100.0 |
Content subtype: combined_19391_2mb7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70-- GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| .SMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYS.SGKKFRSKPQLARYLGGSMDLSTFDFRTGKML
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 460 | 391 | 85.0 |
13C chemical shifts | 332 | 309 | 93.1 |
15N chemical shifts | 80 | 68 | 85.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 147 | 140 | 95.2 |
13C chemical shifts | 144 | 138 | 95.8 |
15N chemical shifts | 67 | 64 | 95.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 313 | 251 | 80.2 |
13C chemical shifts | 188 | 171 | 91.0 |
15N chemical shifts | 13 | 4 | 30.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 24 | 23 | 95.8 |
13C chemical shifts | 24 | 23 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 41 | 89.1 |
13C chemical shifts | 44 | 33 | 75.0 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70-- GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML |||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| .SMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYS.SGKKFRSKPQLARYLGGSMDLSTFDFRTGKML
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70-- GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML ||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| ....RKRWECPALPQGWEREEVPRR.GLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML
RDC restraints
--------10--------20--------30--------40--------50--------60--------70-- GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKML |||| | |||||||| |||||||||||| ||| ||||||| ||||||||||||||| || | .....KRWE..A..QGWEREEV.RRSGLSAGHRDV.YYS..GKKFRSK.QLARYLGGSMDLSTF.FR.G --------10--------20--------30--------40--------50--------60---------