BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	92.8 % (1120 of 1207)	92.6 % (590 of 637)	92.7 % (422 of 455)	93.9 % (108 of 115)
Backbone	95.6 % (570 of 596)	94.1 % (192 of 204)	97.0 % (287 of 296)	94.8 % (91 of 96)
Sidechain	91.3 % (644 of 705)	91.9 % (398 of 433)	90.5 % (229 of 253)	89.5 % (17 of 19)
Aromatic	76.5 % (101 of 132)	87.9 % (58 of 66)	62.3 % (38 of 61)	100.0 % (5 of 5)
Methyl	98.6 % (73 of 74)	100.0 % (37 of 37)	97.3 % (36 of 37)

1. Bm-DAF-16a

NPWGAESYSD LIAKALKSTF DGRMRLNEIY NWFASNVPYF GNRTSQEQSA GWKNSIRHNL SLHSRFMRIQ NEGAGKSSWW VINPDAKPGR NPRRQRSATL E

Show sample condition

Sample

Solvent system 90% H2O, 10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0, Details 0.5mM Bm-DAF-16a-U-15N/13C pH 6.0 20mM sodium phosphate buffer, 50 mM sodium chloride

#	Name	Isotope labeling	Concentration
1	Forkhead box DNA binding domain of Brugia malayi DAF-16a	[U-98% 13C; U-98% 15N]	0.5 mM
2	H2O	natural abundance	90 %
3	D20	natural abundance	10 %
4	sodium phosphate	natural abundance	20 mM
5	sodium chloride	natural abundance	50 mM

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.48 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.48 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.0 ppm, Outliers: 1 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.48 ppm, Outliers: 2 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2MBF, Strand ID: A Detail

Release date

2013-09-09

Citation

The solution structure of the forkhead box-O DNA binding domain of Brugia malayi DAF-16a
Veldkamp, C.T., Peterson, F.C., Casper, S.K., Schoeller, S.J.
Proteins (2014), 82, 3490-3496, PubMed 25297652 , DOI 10.1002/prot.24701 , Abstract

Related entities 1. Forkhead DNA binding domain of Brugia malayi DAF-16a, : 1 : 138 entities Detail

Experiments performed 3 experiments Detail

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_19398_2mbf.nef
Input source #2: Coordindates	2mbf.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-
NPWGAESYSDLIAKALKSTFDGRMRLNEIYNWFASNVPYFGNRTSQEQSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPGRNPRRQRSATL
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
NPWGAESYSDLIAKALKSTFDGRMRLNEIYNWFASNVPYFGNRTSQEQSAGWKNSIRHNLSLHSRFMRIQNEGAGKSSWWVINPDAKPGRNPRRQRSATL
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

-
E
|
E
-

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	101	0	0	100.0

Content subtype: combined_19398_2mbf.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	1141		100.0 (chain: A, length: 101)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	3589 (1)	noe	100.0 (chain: A, length: 101)
1	Dihedral angle restraints	DYANA/DIANA_dihedral_3	OK	114 (114)	.	75.2 (chain: A, length: 101)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 609
  - ¹³C chemical shifts: 423
  - ¹⁵N chemical shifts: 109
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	637	609	95.6
¹³C chemical shifts	455	423	93.0
¹⁵N chemical shifts	125	109	87.2

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	204	198	97.1
¹³C chemical shifts	202	194	96.0
¹⁵N chemical shifts	96	91	94.8

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	433	411	94.9
¹³C chemical shifts	253	229	90.5
¹⁵N chemical shifts	29	18	62.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	39	39	100.0
¹³C chemical shifts	39	38	97.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	66	59	89.4
¹³C chemical shifts	61	38	62.3
¹⁵N chemical shifts	5	5	100.0

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 100.0%
- Total number of restraints: 3355
- Weight of restraints: 1.0 (3355)
- Potential type of restraints: upper-bound-parabolic (3355)
- Range of distance target values: 2.4, 5.5 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: DYANA/DIANA_dihedral_3
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 101, Sequence coverage: 75.2%
- Total number of restraints: 114
- Total number of restraints per polymer type: 114
- Weight of restraints: 1.0 (114)
- Potential type of restraints: square-well-parabolic (114)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords B. malayi, Brugia malayi, DAF-16, filarial parasites, forkhead, FOXO, FOXO3a, insulin/IGF-1 signaling, winged helix

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.687 seconds)

BMRB: 19398

Sample

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. Forkhead DNA binding domain of Brugia malayi DAF-16a, : 1 : 138 entities Detail

Experiments performed 3 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail