KpDsbA
SNAQITDGKQ YITLDKPIAG EPQVLEFFSF YCPHCYQFEE VLHVSDNVRQ KLPEGTKMTK YHVEFLGPLG KDLTQAWAVA IALGVEDKIT APMFEAVQKT QTVQSVADIR KVFVDAGVKG EDYDAAWNSF VVKSLVAQQE KAAADLQLQG VPAMYVNGKY QLNPQGMDTS NMDVFVAQYA DTVKQLVEKK
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS32:SG | 1:CYS35:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.9 % (1847 of 2227) | 89.1 % (1025 of 1151) | 73.4 % (638 of 869) | 88.9 % (184 of 207) |
Backbone | 82.4 % (926 of 1124) | 94.5 % (362 of 383) | 70.5 % (394 of 559) | 93.4 % (170 of 182) |
Sidechain | 85.5 % (1096 of 1282) | 86.3 % (663 of 768) | 85.7 % (419 of 489) | 56.0 % (14 of 25) |
Aromatic | 59.5 % (113 of 190) | 67.4 % (64 of 95) | 50.5 % (47 of 93) | 100.0 % (2 of 2) |
Methyl | 96.4 % (214 of 222) | 96.4 % (107 of 111) | 96.4 % (107 of 111) |
1. entity
SNAQITDGKQ YITLDKPIAG EPQVLEFFSF YCPHCYQFEE VLHVSDNVRQ KLPEGTKMTK YHVEFLGPLG KDLTQAWAVA IALGVEDKIT APMFEAVQKT QTVQSVADIR KVFVDAGVKG EDYDAAWNSF VVKSLVAQQE KAAADLQLQG VPAMYVNGKY QLNPQGMDTS NMDVFVAQYA DTVKQLVEKKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 303 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | KpDsbA | [U-100% 13C; U-100% 15N] | 1.2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 2 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19413_2mbs.nef |
Input source #2: Coordindates | 2mbs.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:30:CYS:SG | A:33:CYS:SG | oxidized, CA 52.459, CB 46.378 ppm | oxidized, CA 63.192, CB 33.843 ppm | 2.042 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 SNAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKT |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SNAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 00-------110-------120-------130-------140-------150-------160-------170-------180-------- QTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK -------110-------120-------130-------140-------150-------160-------170-------180-------190
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 190 | 0 | 0 | 100.0 |
Content subtype: combined_19413_2mbs.nef
Assigned chemical shifts
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 SNAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKT ||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NAQITDGKQYITLDKPIAG.P..LEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKT 00-------110-------120-------130-------140-------150-------160-------170-------180-------- QTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
108 | ARG | NH1 | 76.607 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1151 | 1016 | 88.3 |
13C chemical shifts | 869 | 596 | 68.6 |
15N chemical shifts | 209 | 184 | 88.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 383 | 365 | 95.3 |
13C chemical shifts | 380 | 185 | 48.7 |
15N chemical shifts | 182 | 169 | 92.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 768 | 651 | 84.8 |
13C chemical shifts | 489 | 411 | 84.0 |
15N chemical shifts | 27 | 15 | 55.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 116 | 113 | 97.4 |
13C chemical shifts | 116 | 112 | 96.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 95 | 61 | 64.2 |
13C chemical shifts | 93 | 47 | 50.5 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
-0--------10--------20--------30--------40--------50--------60--------70--------80--------90-------1 SNAQITDGKQYITLDKPIAGEPQVLEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKT ||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NAQITDGKQYITLDKPIAG.P..LEFFSFYCPHCYQFEEVLHVSDNVRQKLPEGTKMTKYHVEFLGPLGKDLTQAWAVAIALGVEDKITAPMFEAVQKT 00-------110-------120-------130-------140-------150-------160-------170-------180-------- QTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| QTVQSVADIRKVFVDAGVKGEDYDAAWNSFVVKSLVAQQEKAAADLQLQGVPAMYVNGKYQLNPQGMDTSNMDVFVAQYADTVKQLVEKK