NMR solution structure of oxidised PaDsbA
GDDYTAGKEY VELSSPVPVS QPGKIEVVEL FWYGCPHCYA FEPTIVPWSE KLPADVHFVR LPALFGGIWN VHGQMFLTLE SMGVEHDVHN AVFEAIHKEH KKLATPEEMA DFLAGKGVDK EKFLSTYNSF AIKGQMEKAK KLAMAYQVTG VPTMVVNGKY RFDIGSAGGP EETLKLADYL IEKERAAAKK
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS35:SG | 1:CYS38:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.4 % (1815 of 2230) | 87.4 % (1009 of 1154) | 71.2 % (631 of 886) | 92.1 % (175 of 190) |
Backbone | 82.0 % (917 of 1118) | 93.2 % (359 of 385) | 70.9 % (393 of 554) | 92.2 % (165 of 179) |
Sidechain | 83.0 % (1068 of 1286) | 84.5 % (650 of 769) | 80.6 % (408 of 506) | 90.9 % (10 of 11) |
Aromatic | 64.9 % (148 of 228) | 77.2 % (88 of 114) | 51.4 % (57 of 111) | 100.0 % (3 of 3) |
Methyl | 96.6 % (197 of 204) | 96.1 % (98 of 102) | 97.1 % (99 of 102) |
1. entity
GDDYTAGKEY VELSSPVPVS QPGKIEVVEL FWYGCPHCYA FEPTIVPWSE KLPADVHFVR LPALFGGIWN VHGQMFLTLE SMGVEHDVHN AVFEAIHKEH KKLATPEEMA DFLAGKGVDK EKFLSTYNSF AIKGQMEKAK KLAMAYQVTG VPTMVVNGKY RFDIGSAGGP EETLKLADYL IEKERAAAKKSolvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | indirect | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | PaDsbA | [U-100% 13C; U-100% 15N] | 2 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 10 % | |
6 | DSS | natural abundance | 1 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19417_2mbt.nef |
Input source #2: Coordindates | 2mbt.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:37:CYS:SG | A:40:CYS:SG | oxidized, CA 51.825, CB 45.562 ppm | oxidized, CA 63.756, CB 34.132 ppm | 2.044 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -----110-------120-------130-------140-------150-------160-------170-------180-------190-- KKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK -------110-------120-------130-------140-------150-------160-------170-------180-------190
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 190 | 0 | 0 | 100.0 |
Content subtype: combined_19417_2mbt.nef
Assigned chemical shifts
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| | |||||||||||| .DDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFG.IWNVHGQMFLTLESMGV.H..HNAVFEAIHKEH -----110-------120-------130-------140-------150-------160-------170-------180-------190-- KKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
74 | HIS | HD1 | 10.864 |
74 | HIS | NE2 | 186.474 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1154 | 1008 | 87.3 |
13C chemical shifts | 886 | 591 | 66.7 |
15N chemical shifts | 193 | 175 | 90.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 385 | 359 | 93.2 |
13C chemical shifts | 380 | 185 | 48.7 |
15N chemical shifts | 179 | 163 | 91.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 769 | 649 | 84.4 |
13C chemical shifts | 506 | 406 | 80.2 |
15N chemical shifts | 14 | 12 | 85.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 108 | 106 | 98.1 |
13C chemical shifts | 108 | 106 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 114 | 83 | 72.8 |
13C chemical shifts | 111 | 54 | 48.6 |
15N chemical shifts | 3 | 3 | 100.0 |
Covalent bonds
Distance restraints
------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-- GDDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLESMGVEHDVHNAVFEAIHKEH ||||||||||||||||||||| |||||||||| |||||||||||||||||||||||||||||||| ||||||||||||||||| | |||||||||||| .DDYTAGKEYVELSSPVPVSQP.KIEVVELFWY.CPHCYAFEPTIVPWSEKLPADVHFVRLPALFG.IWNVHGQMFLTLESMGV.H..HNAVFEAIHKEH -----110-------120-------130-------140-------150-------160-------170-------180-------190-- KKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| KKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKYRFDIGSAGGPEETLKLADYLIEKERAAAKK