Structural Basis of a Thiopeptide Antibiotic Multidrug Resistance System from Streptomyces lividans:Promothiocin A in Complex with TipAS
MGINLTPEEK FEVFGDFDPD QYEEEVRERW GNTDAYRQSK EKTASYTKED WQRIQDEADE LTRRFVALMD AGEPADSEGA MDAAEDHRQG IARNHYDCGY EMHTCLGEMY VSDERFTRNI DAAKPGLAAY MRDAILANAV RHTP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 95.1 % (1584 of 1666) | 96.3 % (834 of 866) | 93.6 % (603 of 644) | 94.2 % (147 of 156) |
Backbone | 95.8 % (847 of 884) | 98.3 % (298 of 303) | 94.3 % (412 of 437) | 95.1 % (137 of 144) |
Sidechain | 94.6 % (871 of 921) | 95.2 % (536 of 563) | 93.9 % (325 of 346) | 83.3 % (10 of 12) |
Aromatic | 98.6 % (144 of 146) | 100.0 % (73 of 73) | 97.2 % (69 of 71) | 100.0 % (2 of 2) |
Methyl | 96.7 % (118 of 122) | 100.0 % (61 of 61) | 93.4 % (57 of 61) |
1. TipAS
MGINLTPEEK FEVFGDFDPD QYEEEVRERW GNTDAYRQSK EKTASYTKED WQRIQDEADE LTRRFVALMD AGEPADSEGA MDAAEDHRQG IARNHYDCGY EMHTCLGEMY VSDERFTRNI DAAKPGLAAY MRDAILANAV RHTP2. promothiocin A
SXVGXAXAXXSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TipAS | [U-98% 15N] | 1 mM | |
2 | promothiocin A | natural abundance | 2 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TipAS | [U-98% 15N] | 1 mM | |
2 | promothiocin A | natural abundance | 2 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TipAS | [U-98% 15N] | 1 mM | |
2 | promothiocin A | natural abundance | 2 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | TipAS | [U-98% 15N] | 1 mM | |
2 | promothiocin A | natural abundance | 2 mM | |
3 | potassium phosphate | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.02 w/v | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 600 MHz TXI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in phage Pf1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | TipAS | [U-100% 13C; U-100% 15N] | 0.8 mM | |
19 | promothiocin A | natural abundance | 1.6 mM | |
20 | potassium phosphate | natural abundance | 10 mM | |
21 | Pf1 phage | natural abundance | 10 mg/mL | |
22 | H2O | natural abundance | 95 % | |
23 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
8 | promothiocin A | natural abundance | 2 mM | |
9 | potassium phosphate | natural abundance | 50 mM | |
10 | sodium azide | natural abundance | 0.02 w/v | |
11 | H2O | natural abundance | 95 % | |
12 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in phage Pf1
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | TipAS | [U-100% 13C; U-100% 15N] | 0.8 mM | |
19 | promothiocin A | natural abundance | 1.6 mM | |
20 | potassium phosphate | natural abundance | 10 mM | |
21 | Pf1 phage | natural abundance | 10 mg/mL | |
22 | H2O | natural abundance | 95 % | |
23 | D2O | natural abundance | 5 % |
Bruker DRX - 800 MHz TCI probe head
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 298 K, pH 5.9, Details 13C-15N labeled TipAS in complex with promothiocin A in D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
13 | TipAS | [U-100% 13C; U-100% 15N] | 1 mM | |
14 | promothiocin A | natural abundance | 2 mM | |
15 | potassium phosphate | natural abundance | 50 mM | |
16 | sodium azide | natural abundance | 0.02 w/v | |
17 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19421_2mbz.nef |
Input source #2: Coordindates | 2mbz.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | True (see coodinates for details) |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Error |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
2:1:SER:C | 2:2:BB9:N | unknown | unknown | n/a |
2:2:BB9:C | 2:3:VAL:N | unknown | unknown | n/a |
2:4:GLY:C | 2:5:MOZ:N | unknown | unknown | n/a |
2:5:MOZ:C | 2:6:ALA:N | unknown | unknown | n/a |
2:6:ALA:C | 2:7:BB9:N | unknown | unknown | n/a |
2:7:BB9:C | 2:8:ALA:N | unknown | unknown | n/a |
2:8:ALA:C | 2:9:MOZ:N | unknown | unknown | n/a |
2:9:MOZ:C | 2:10:NAK:NAB | unknown | unknown | n/a |
2:10:NAK:CAF | 2:11:ALA:N | unknown | unknown | n/a |
2:11:ALA:C | 2:12:NH2:N | unknown | unknown | n/a |
2:1:SER:CA | 2:9:MOZ:C | unknown | unknown | n/a |
2:4:GLY:C | 2:5:MOZ:OG | unknown | unknown | n/a |
2:1:SER:CB | 2:10:NAK:CAE | unknown | unknown | n/a |
2:8:ALA:C | 2:9:MOZ:OG | unknown | unknown | n/a |
2:6:ALA:C | 2:7:BB9:SG | unknown | unknown | n/a |
2:1:SER:C | 2:2:BB9:SG | unknown | unknown | n/a |
1:105:CYS:SG | 2:11:ALA:CB | unknown | unknown | n/a |
Non-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 502 | BB9 | (2Z)-2-amino-3-sulfanylprop-2-enoic acid | Assigned chemical shifts, Coordinates |
B | 505 | MOZ | (2Z)-2-amino-3-hydroxybut-2-enoic acid | Assigned chemical shifts, Coordinates |
B | 507 | BB9 | (2Z)-2-amino-3-sulfanylprop-2-enoic acid | Assigned chemical shifts, Coordinates |
B | 509 | MOZ | (2Z)-2-amino-3-hydroxybut-2-enoic acid | Assigned chemical shifts, Coordinates |
B | 510 | NAK | AMINO-ACRYLATE | Assigned chemical shifts, Coordinates |
B | 512 | NH2 | AMINO GROUP | Assigned chemical shifts, Coordinates |
Sequence alignments
110-----120-------130-------140-------150-------160-------170-------180-------190-------200-------21 MGINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------220-------230-------240-------250--- EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP |||||||||||||||||||||||||||||||||||||||||||| EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP -------110-------120-------130-------140----
-------510-- SXVGXAXAXXAX |||||||||||| SXVGXAXAXXAX --------10--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 144 | 0 | 0 | 100.0 |
B | B | 12 | 0 | 0 | 100.0 |
Content subtype: combined_19421_2mbz.nef
Assigned chemical shifts
110-----120-------130-------140-------150-------160-------170-------180-------190-------200-------21 MGINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY 0-------220-------230-------240-------250--- EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP |||||||||||||||||||||||||||||||||||||||||||| EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
162 | ARG | HH12 | 7.572 |
162 | ARG | HH11 | 7.219 |
162 | ARG | NH2 | 69.773 |
196 | HIS | HE2 | 11.578 |
196 | HIS | NE2 | 192.825 |
212 | HIS | HE2 | 15.219 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 848 | 817 | 96.3 |
13C chemical shifts | 628 | 600 | 95.5 |
15N chemical shifts | 163 | 155 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 292 | 289 | 99.0 |
13C chemical shifts | 288 | 276 | 95.8 |
15N chemical shifts | 139 | 137 | 98.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 556 | 528 | 95.0 |
13C chemical shifts | 340 | 324 | 95.3 |
15N chemical shifts | 24 | 18 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 63 | 61 | 96.8 |
13C chemical shifts | 63 | 60 | 95.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 73 | 100.0 |
13C chemical shifts | 71 | 69 | 97.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Covalent bonds
Distance restraints
110-----120-------130-------140-------150-------160-------170-------180-------190-------200-------21 MGINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .GINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY 0-------220-------230-------240-------250--- EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP |||||||||||||||||||||||||||||||||||||||||||| EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP
Dihedral angle restraints
110-----120-------130-------140-------150-------160-------170-------180-------190-------200-------21 MGINLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNHYDCGY ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| ..INLTPEEKFEVFGDFDPDQYEEEVRERWGNTDAYRQSKEKTASYTKEDWQRIQDEADELTRRFVALMDAGEPADSEGAMDAAEDHRQGIARNH.DCGY 0-------220-------230-------240-------250--- EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP |||||||||||||||||||||||||||||||||||||||||||| EMHTCLGEMYVSDERFTRNIDAAKPGLAAYMRDAILANAVRHTP