Solution NMR structure of a putative thioredoxin (ECH_0218) in the reduced state from Ehrlichia chaffeensis, the etiological agent responsible for human monocytic ehrlichiosis. Seattle Structural Genomics Center for Infectious Disease target EhchA.00546.a
MGTLEAQTQG PGSMIEQIGD SEFDNKVTSC NDNILILVDF WAPWCGPCRS LEPQLEKLAQ QYTENVKIYK INIEDNQDVA TQYGVSAIPT ILMFKNGKKL SQVIGADISK IISEINNNIN
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.1 % (1067 of 1403) | 72.4 % (529 of 731) | 79.1 % (423 of 535) | 83.9 % (115 of 137) |
Backbone | 83.1 % (590 of 710) | 80.2 % (195 of 243) | 83.8 % (295 of 352) | 87.0 % (100 of 115) |
Sidechain | 71.2 % (573 of 805) | 68.4 % (334 of 488) | 75.9 % (224 of 295) | 68.2 % (15 of 22) |
Aromatic | 53.8 % (42 of 78) | 53.8 % (21 of 39) | 56.8 % (21 of 37) | 0.0 % (0 of 2) |
Methyl | 79.3 % (111 of 140) | 77.1 % (54 of 70) | 81.4 % (57 of 70) |
1. entity
MGTLEAQTQG PGSMIEQIGD SEFDNKVTSC NDNILILVDF WAPWCGPCRS LEPQLEKLAQ QYTENVKIYK INIEDNQDVA TQYGVSAIPT ILMFKNGKKL SQVIGADISK IISEINNNINSolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 100 (±2.0) mM | |
8 | TRIS | natural abundance | 20 (±0.5) mM | |
9 | DTT | natural abundance | 1 (±0.2) mM | |
10 | entity | [U-99% 15N] | 1 (±0.2) mM | |
11 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium chloride | natural abundance | 100 (±2.0) mM | |
8 | TRIS | natural abundance | 20 (±0.5) mM | |
9 | DTT | natural abundance | 1 (±0.2) mM | |
10 | entity | [U-99% 15N] | 1 (±0.2) mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 293 (±1) K, pH 7.0 (±0.1)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium chloride | natural abundance | 100 (±2.0) mM | |
2 | TRIS | natural abundance | 20 (±0.5) mM | |
3 | DTT | natural abundance | 1 (±0.2) mM | |
4 | entity | [U-99% 13C; U-99% 15N] | 1 (±0.2) mM | |
5 | H2O | natural abundance | 93 % | |
6 | D2O | natural abundance | 7 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19452_6amr.nef |
Input source #2: Coordindates | 6amr.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTIL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTIL -------110-------120-------- MFKNGKKLSQVIGADISKIISEINNNIN |||||||||||||||||||||||||||| MFKNGKKLSQVIGADISKIISEINNNIN
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 128 | 0 | 0 | 100.0 |
Content subtype: combined_19452_6amr.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTIL |||||||||||||||||||||||||||||||||||||||| ||||||||||||||||| |||||||||||||| ||| ........MGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDF............PQLEKLAQQYTENVKIY..NIEDNQDVATQYGV....TIL -------110-------120-------- MFKNGKKLSQVIGADISKIISEINNNIN |||||||||||||||||||||||||||| MFKNGKKLSQVIGADISKIISEINNNIN
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
32 | ASP | CG | 8.33 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 573 | 409 | 71.4 |
1H chemical shifts | 777 | 512 | 65.9 |
15N chemical shifts | 146 | 109 | 74.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 256 | 190 | 74.2 |
1H chemical shifts | 259 | 187 | 72.2 |
15N chemical shifts | 123 | 96 | 78.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 317 | 219 | 69.1 |
1H chemical shifts | 518 | 325 | 62.7 |
15N chemical shifts | 23 | 13 | 56.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 75 | 57 | 76.0 |
1H chemical shifts | 75 | 52 | 69.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 49 | 21 | 42.9 |
1H chemical shifts | 51 | 21 | 41.2 |
15N chemical shifts | 2 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTIL |||||||||||||||||||||||||||||| ||||||||||||||||| | |||||||||||| ||| .................GPGSMIEQIGDSEFDNKVTSCNDNILILVD.............PQLEKLAQQYTENVKIY..N.EDNQDVATQYGV....TIL -------110-------120-------- MFKNGKKLSQVIGADISKIISEINNNIN |||||||||||||||||||||||||||| MFKNGKKLSQVIGADISKIISEINNNIN
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAHHHHHHMGTLEAQTQGPGSMIEQIGDSEFDNKVTSCNDNILILVDFWAPWCGPCRSLEPQLEKLAQQYTENVKIYKINIEDNQDVATQYGVSAIPTIL ||||||||||||||||||||||||||| |||||||||||||||||| ||||||||||||| |||| .....................MIEQIGDSEFDNKVTSCNDNILILVDF............PQLEKLAQQYTENVKIYK..IEDNQDVATQYGV...PTIL -------110-------120-------- MFKNGKKLSQVIGADISKIISEINNNIN |||||||||||||||||||||||||||| MFKNGKKLSQVIGADISKIISEINNNIN