p87m-BMRB
DNQKALEEQM NSINSVNDKL NKGKGKLSLS MNGNQLKATS SNAGYGISYE DKNWGIFVNG EKVYTFNEKS TVGNISNDIN KLNIKGMYIE IKQI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.8 % (1052 of 1110) | 96.4 % (563 of 584) | 91.5 % (377 of 412) | 98.2 % (112 of 114) |
Backbone | 98.9 % (558 of 564) | 97.5 % (192 of 197) | 99.6 % (272 of 273) | 100.0 % (94 of 94) |
Sidechain | 91.8 % (579 of 631) | 95.9 % (371 of 387) | 84.8 % (190 of 224) | 90.0 % (18 of 20) |
Aromatic | 51.6 % (33 of 64) | 100.0 % (32 of 32) | 0.0 % (0 of 31) | 100.0 % (1 of 1) |
Methyl | 100.0 % (88 of 88) | 100.0 % (44 of 44) | 100.0 % (44 of 44) |
1. p87m-HlyIIC
DNQKALEEQM NSINSVNDKL NKGKGKLSLS MNGNQLKATS SNAGYGISYE DKNWGIFVNG EKVYTFNEKS TVGNISNDIN KLNIKGMYIE IKQISolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | EDTA | natural abundance | 1 mM | |
9 | AEBSF | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.05 % w/v |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | AEBSF | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.05 % w/v |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | EDTA | natural abundance | 1 mM | |
9 | AEBSF | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | EDTA | natural abundance | 1 mM | |
9 | AEBSF | natural abundance | 1 mM | |
10 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | AEBSF | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | AEBSF | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | AEBSF | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p87m-HlyIIC | [U-99% 13C; U-99% 15N] | 0.4 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | AEBSF | natural abundance | 1 mM | |
5 | sodium azide | natural abundance | 0.05 % w/v |
Varian INOVA - 800 MHz with cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | p87m-HlyIIC | [U-99% 15N] | 0.4 mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | EDTA | natural abundance | 1 mM | |
14 | AEBSF | natural abundance | 1 mM | |
15 | sodium azide | natural abundance | 0.05 % w/v |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19463_2n67.nef |
Input source #2: Coordindates | 2n67.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
B | B | 94 | 0 | 0 | 100.0 |
Content subtype: combined_19463_2n67.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- DNQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| DNQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 584 | 571 | 97.8 |
13C chemical shifts | 412 | 377 | 91.5 |
15N chemical shifts | 114 | 112 | 98.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 197 | 196 | 99.5 |
13C chemical shifts | 188 | 187 | 99.5 |
15N chemical shifts | 94 | 94 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 387 | 375 | 96.9 |
13C chemical shifts | 224 | 190 | 84.8 |
15N chemical shifts | 20 | 18 | 90.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 47 | 46 | 97.9 |
13C chemical shifts | 47 | 44 | 93.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 32 | 100.0 |
13C chemical shifts | 31 | 0 | 0.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- DNQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .NQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90---- DNQKALEEQMNSINSVNDKLNKGKGKLSLSMNGNQLKATSSNAGYGISYEDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI |||||||||||||||||||| |||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| .NQKALEEQMNSINSVNDKLN...GKLSLSMNGNQLKATSSNAGYGIS.EDKNWGIFVNGEKVYTFNEKSTVGNISNDINKLNIKGMYIEIKQI