BMRBj - BMREntryMaster

Found 1 Document (0.831 seconds)

BMRB: 19486

2MDG

Solution NMR Structure of Zinc finger protein 423 from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR7298F

Authors

Lee, D., Kohan, E., Pederson, K., Janjua, H., Xiao, R., Everett, J.K., Acton, T.B., Montelione, G.T., Prestegard, J.H.

Assembly

Hr7298f

Entity

1. HR7298F (polymer, Thiol state: all other bound), 55 monomers, 6324.219 Da Detail

MGSHKCNVCS RTFFSENGLR EHLQTHRGPA KHYMCPICGE RFPSLLTLTE HKVTH

2. ZINC ION (non-polymer), 65.409 × 2 Da

Total weight

6455.037 Da

Max. entity weight

6324.219 Da

Source organism

Homo sapiens

Exptl. method

solution NMR

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 100.0 %, Completeness: 86.7 %, Completeness (bb): 98.1 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	86.7 % (556 of 641)	86.9 % (291 of 335)	85.3 % (214 of 251)	92.7 % (51 of 55)
Backbone	98.1 % (318 of 324)	99.1 % (110 of 111)	97.5 % (157 of 161)	98.1 % (51 of 52)
Sidechain	78.5 % (289 of 368)	80.8 % (181 of 224)	76.6 % (108 of 141)	0.0 % (0 of 3)
Aromatic	0.0 % (0 of 62)	0.0 % (0 of 31)	0.0 % (0 of 31)
Methyl	100.0 % (44 of 44)	100.0 % (22 of 22)	100.0 % (22 of 22)

1. HR7298F

MGSHKCNVCS RTFFSENGLR EHLQTHRGPA KHYMCPICGE RFPSLLTLTE HKVTH

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

Sample #2

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details C12E5 solution for RDC

#	Name	Isotope labeling	Concentration
12	HR7298F.0059	[U-5% 13C; U-100% 15N]	0.51 mM
13	NaN3	natural abundance	0.02 %
14	DTT	natural abundance	10 mM
15	CaCL2	natural abundance	5 mM
16	NaCL	natural abundance	100 mM
17	Proteinase Inhibitors	natural abundance	1 na
18	MES pH 6.5	natural abundance	20 mM
19	D2O	[U-100% 2H]	5 %
20	DSS	natural abundance	50 uM
21	C12E5 PEG/Hexanol	natural abundance	4.2 %
22	ZnSO4	natural abundance	50 uM
23	H2O	natural abundance	95 %

Sample #3

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.51 mM HR7298F.009, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
24	HR7298F.009	[U-5% 13C; U-100% 15N]	0.51 mM
25	NaN3	natural abundance	0.02 %
26	DTT	natural abundance	10 mM
27	CaCL2	natural abundance	5 mM
28	NaCL	natural abundance	100 mM
29	Proteinase Inhibitors	natural abundance	1 na
30	MES pH 6.5	natural abundance	20 mM
31	D2O	[U-100% 2H]	5 %
32	DSS	natural abundance	50 uM
33	ZnSO4	natural abundance	50 uM
34	H2O	natural abundance	95 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details PEG/hexanol NC sample for RDCs

#	Name	Isotope labeling	Concentration
35	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
36	NaN3	natural abundance	0.02 %
37	DTT	natural abundance	10 mM
38	CaCL2	natural abundance	5 mM
39	NaCL	natural abundance	100 mM
40	Proteinase Inhibitors	natural abundance	1 na
41	MES pH 6.5	natural abundance	20 mM
42	D2O	[U-100% 2H]	10 %
43	DSS	natural abundance	50 uM
44	ZnSO4	natural abundance	50 uM
45	C12E5 PEG?Hexanol	natural abundance	4.2 %
46	H2O	natural abundance	90 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.33 ppm, Outliers: 5 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.33 ppm, Outliers: 5 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 0.13 ppm, Outliers: 3 Detail

LACS Plot; CO

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: 1.61 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2MDG, Strand ID: A Detail

Release date

2013-09-22

Related entities 1. HR7298F, : 1 : 6 : 1848 entities Detail

Interaction partners 1. HR7298F, : 9 interactors Detail

More details for 9 interactors identified by 3 citations

Experiments performed 14 experiments Detail

1 2D 1H-15N HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

2 2D 1H-13C HSQC aliphatic

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

3 3D HNCO

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

4 3D CBCA(CO)NH

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

5 3D HNCACB

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

6 3D H(CCO)NH

Instrument

Varian Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

7 3D HCCH-TOCSY

Instrument

Varian Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

8 3D 1H-15N NOESY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.51 mM HR7298F.009, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
24	HR7298F.009	[U-5% 13C; U-100% 15N]	0.51 mM
25	NaN3	natural abundance	0.02 %
26	DTT	natural abundance	10 mM
27	CaCL2	natural abundance	5 mM
28	NaCL	natural abundance	100 mM
29	Proteinase Inhibitors	natural abundance	1 na
30	MES pH 6.5	natural abundance	20 mM
31	D2O	[U-100% 2H]	5 %
32	DSS	natural abundance	50 uM
33	ZnSO4	natural abundance	50 uM
34	H2O	natural abundance	95 %

9 3D 1H-13C NOESY aliphatic

Instrument

Varian Avance - 900 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

10 2D 1H-13C CT HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.51 mM HR7298F.009, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
24	HR7298F.009	[U-5% 13C; U-100% 15N]	0.51 mM
25	NaN3	natural abundance	0.02 %
26	DTT	natural abundance	10 mM
27	CaCL2	natural abundance	5 mM
28	NaCL	natural abundance	100 mM
29	Proteinase Inhibitors	natural abundance	1 na
30	MES pH 6.5	natural abundance	20 mM
31	D2O	[U-100% 2H]	5 %
32	DSS	natural abundance	50 uM
33	ZnSO4	natural abundance	50 uM
34	H2O	natural abundance	95 %

11 2D 1H-15N J-modulation HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

12 2D 1H-15N J-modulation HSQC

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details C12E5 solution for RDC

#	Name	Isotope labeling	Concentration
12	HR7298F.0059	[U-5% 13C; U-100% 15N]	0.51 mM
13	NaN3	natural abundance	0.02 %
14	DTT	natural abundance	10 mM
15	CaCL2	natural abundance	5 mM
16	NaCL	natural abundance	100 mM
17	Proteinase Inhibitors	natural abundance	1 na
18	MES pH 6.5	natural abundance	20 mM
19	D2O	[U-100% 2H]	5 %
20	DSS	natural abundance	50 uM
21	C12E5 PEG/Hexanol	natural abundance	4.2 %
22	ZnSO4	natural abundance	50 uM
23	H2O	natural abundance	95 %

13 2D 1H-15N CO filtered TROSY

Instrument

Varian INOVA - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.17 mM HR7298F.005, 90% H2O/10% D2O

#	Name	Isotope labeling	Concentration
1	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
2	NaN3	natural abundance	0.02 %
3	DTT	natural abundance	10 mM
4	CaCL2	natural abundance	5 mM
5	NaCL	natural abundance	100 mM
6	Proteinase Inhibitors	natural abundance	1 na
7	MES pH 6.5	natural abundance	20 mM
8	D2O	[U-100% 2H]	10 %
9	DSS	natural abundance	50 uM
10	ZnSO4	natural abundance	50 uM
11	H2O	natural abundance	90 %

14 2D 1H-15N CO-filtered TROSY

Instrument

Varian INOVA - 600 MHz

Sample

State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details PEG/hexanol NC sample for RDCs

#	Name	Isotope labeling	Concentration
35	HR7298F.005	[U-100% 13C; U-100% 15N]	0.17 mM
36	NaN3	natural abundance	0.02 %
37	DTT	natural abundance	10 mM
38	CaCL2	natural abundance	5 mM
39	NaCL	natural abundance	100 mM
40	Proteinase Inhibitors	natural abundance	1 na
41	MES pH 6.5	natural abundance	20 mM
42	D2O	[U-100% 2H]	10 %
43	DSS	natural abundance	50 uM
44	ZnSO4	natural abundance	50 uM
45	C12E5 PEG?Hexanol	natural abundance	4.2 %
46	H2O	natural abundance	90 %

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints	combined_19486_2mdg.nef
Input source #2: Coordindates	2mdg.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	True (see coodinates for details)
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

Ptnr_site_1	Ptnr_site_2	Redox_state_prediction_1	Redox_state_prediction_2	Distance (Å)
1:55:HIS:NE2	2:2:ZN:ZN	unknown	unknown	n/a
1:26:HIS:NE2	2:1:ZN:ZN	unknown	unknown	n/a
1:51:HIS:NE2	2:2:ZN:ZN	unknown	unknown	n/a
1:22:HIS:NE2	2:1:ZN:ZN	unknown	unknown	n/a
1:9:CYS:SG	2:1:ZN:ZN	unknown	unknown	n/a
1:35:CYS:SG	2:2:ZN:ZN	unknown	unknown	n/a
1:6:CYS:SG	2:1:ZN:ZN	unknown	unknown	n/a
1:38:CYS:SG	2:2:ZN:ZN	unknown	unknown	n/a

Non-standard residues

Chain_ID	Seq_ID	Comp_ID	Chem_comp_name	Experimental evidences
B	1	ZN	ZINC ION	None
B	2	ZN	ZINC ION	None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--------10--------20--------30--------40--------50-----
MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
MGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVTH

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	55	0	0	100.0

Content subtype: combined_19486_2mdg.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Covalent bonds	assembly	OK	8		No information
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	554		100.0 (chain: A, length: 55)
1	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	514 (1)	noe	96.4 (chain: A, length: 55)
1	Dihedral angle restraints	CNS/XPLOR_dihedral_4	OK	75 (75)	.	96.4 (chain: A, length: 55)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 55, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 291
  - ¹³C chemical shifts: 212
  - ¹⁵N chemical shifts: 51
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	335	291	86.9
¹³C chemical shifts	251	212	84.5
¹⁵N chemical shifts	59	51	86.4

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	111	110	99.1
¹³C chemical shifts	110	106	96.4
¹⁵N chemical shifts	52	51	98.1

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	224	181	80.8
¹³C chemical shifts	141	106	75.2
¹⁵N chemical shifts	7	0	0.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	24	22	91.7
¹³C chemical shifts	24	20	83.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	31	0	0.0
¹³C chemical shifts	31	0	0.0

Covalent bonds

Saveframe: assembly
- Status: OK

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_3
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 55, Sequence coverage: 96.4%
- Total number of restraints: 512
- Weight of restraints: 1.0 (512)
- Potential type of restraints: square-well-parabolic (512)
- Range of distance target values: 2.25, 3.4 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
  - Chain_ID: B
    None
- Distance restraints on contact map

Dihedral angle restraints

Saveframe: CNS/XPLOR_dihedral_4
- Status: OK
- Experiment type: .
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 55, Sequence coverage: 96.4%
- Total number of restraints: 75
- Total number of restraints per polymer type: 75
- Weight of restraints: 1.0 (75)
- Potential type of restraints: square-well-parabolic (75)
- Plot of Phi-Psi angle restraints
- Dihedral angle restraints per residue
  - Chain_ID: A

Keywords C2H2, Hr7298F, PSI:Biology, Zinc, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), Protein NMR, Protein Structure Initiative, PSI-Biology, Structural Genomics, Target HR7298F

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (0.831 seconds)

BMRB: 19486

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. HR7298F, : 1 : 6 : 1848 entities Detail

Interaction partners 1. HR7298F, : 9 interactors Detail

Experiments performed 14 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail