gp1.2
MGRLYSGNLA AFKAATNKLF QLDLAVIYDD WYDAYTRKDC IRLRIEDRSG NLIDTSTFYH HDEDVLFNMC TDWLNHMYDQ LKDWKMGRLY SGNLAAFKAA TNKLFQLDLA VIYDDWYDAY TRKDCIRLRI EDRSGNLIDT STFYHHDEDV LFNMCTDWLN HMYDQLKDWK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 42.6 % (875 of 2054) | 43.8 % (463 of 1058) | 40.2 % (324 of 806) | 46.3 % (88 of 190) |
Backbone | 44.5 % (454 of 1020) | 48.8 % (169 of 346) | 39.7 % (200 of 504) | 50.0 % (85 of 170) |
Sidechain | 42.2 % (505 of 1198) | 41.3 % (294 of 712) | 44.6 % (208 of 466) | 15.0 % (3 of 20) |
Aromatic | 39.0 % (106 of 272) | 39.0 % (53 of 136) | 38.5 % (50 of 130) | 50.0 % (3 of 6) |
Methyl | 55.8 % (96 of 172) | 55.8 % (48 of 86) | 55.8 % (48 of 86) |
1. entity
MGRLYSGNLA AFKAATNKLF QLDLAVIYDD WYDAYTRKDC IRLRIEDRSG NLIDTSTFYH HDEDVLFNMC TDWLNHMYDQ LKDWKMGRLY SGNLAAFKAA TNKLFQLDLA VIYDDWYDAY TRKDCIRLRI EDRSGNLIDT STFYHHDEDV LFNMCTDWLN HMYDQLKDWKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-100% 13C; U-100% 15N] | 0.2 mM | |
2 | sodium chloride | natural abundance | 46 mM | |
3 | potassium chloride | natural abundance | 1 mM | |
4 | sodium phosphate | natural abundance | 1.4 mM | |
5 | potassium phosphate | natural abundance | 0.05 mM | |
6 | H2O | natural abundance | 90 % | |
7 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_19498_2mdp.nef |
Input source #2: Coordindates | 2mdp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80----- MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 85 | 0 | 0 | 100.0 |
Content subtype: combined_19498_2mdp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80----- MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK | |||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||| M....SGNLAAFKAATNKLFQLDLAVIYDDWYDAYTR..CIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 529 | 404 | 76.4 |
13C chemical shifts | 403 | 266 | 66.0 |
15N chemical shifts | 100 | 75 | 75.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 173 | 140 | 80.9 |
13C chemical shifts | 170 | 78 | 45.9 |
15N chemical shifts | 85 | 72 | 84.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 356 | 264 | 74.2 |
13C chemical shifts | 233 | 188 | 80.7 |
15N chemical shifts | 15 | 3 | 20.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 42 | 91.3 |
13C chemical shifts | 46 | 42 | 91.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 68 | 53 | 77.9 |
13C chemical shifts | 65 | 50 | 76.9 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK |||||||||||||||||||||||| |||| |||||||||||||||||||| |||||||||||||||||||||||| ......GNLAAFKAATNKLFQLDLAVIYDD...AYTR...IRLRIEDRSGNLIDTSTFYH.DEDVLFNMCTDWLNHMYDQLKDWK
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK |||||||||||||||||||||||| |||| ||||||||| |||||||||||||||||||||||||||||||||| .......NLAAFKAATNKLFQLDLAVIYDDW..AYTR...IRLRIEDRS..LIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80----- MGRLYSGNLAAFKAATNKLFQLDLAVIYDDWYDAYTRKDCIRLRIEDRSGNLIDTSTFYHHDEDVLFNMCTDWLNHMYDQLKDWK || || | | |||||||||| ||| |||||| ||||||||||| | | ||||| ||| | | || .......NL..FK..T.K...LDLAVIYDDW..AYT....IRLRIE.RSGNLIDTSTF....E.V.FNMCT.WLN....Q.K.WK