BMRBj - BMREntryMaster

	Total	¹H	¹³C	¹⁵N
All	72.9 % (949 of 1301)	78.2 % (533 of 682)	64.5 % (325 of 504)	79.1 % (91 of 115)
Backbone	70.8 % (470 of 664)	80.1 % (185 of 231)	61.8 % (202 of 327)	78.3 % (83 of 106)
Sidechain	76.0 % (561 of 738)	77.2 % (348 of 451)	73.7 % (205 of 278)	88.9 % (8 of 9)
Aromatic	62.1 % (72 of 116)	75.9 % (44 of 58)	47.4 % (27 of 57)	100.0 % (1 of 1)
Methyl	91.0 % (91 of 100)	90.0 % (45 of 50)	92.0 % (46 of 50)

1. dsRBD3

GSSHHHHHHS SGLVPRGSHM MPNKVRKIGE LVRYLNTNPV GGLLEYARSH GFAAEFKLVD QSGPPHEPKF VYQAKVGGRW FPAVCAHSKK QGKQEAADAA LRVLIGENEK AER

Show sample condition

Sample #1

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

Sample #2

Solvent system 100% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
7	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
8	sodium phosphate	natural abundance	20 mM
9	potassium chloride	natural abundance	100 mM
10	DTT	natural abundance	1 mM
11	D2O	natural abundance	100 %

Sample #3

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
12	dsRBD3	[U-99% 15N]	0.7 ~ 0.9 mM
13	sodium phosphate	natural abundance	20 mM
14	potassium chloride	natural abundance	100 mM
15	DTT	natural abundance	1 mM
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

Sample #4

Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
18	dsRBD3	natural abundance	0.7 ~ 0.9 mM
19	sodium phosphate	natural abundance	20 mM
20	potassium chloride	natural abundance	100 mM
21	DTT	natural abundance	1 mM
22	H2O	natural abundance	90 %
23	D2O	natural abundance	10 %

LACS Plot; CA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.62 ppm, Outliers: 1 Detail

LACS Plot; CB

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.62 ppm, Outliers: 1 Detail

LACS Plot; HA

Atom type	Mol. common name	Atom group	Ref. method	Ref. type	Shift ratio
¹³C	DSS	methyl protons	na	indirect	0.2514495
¹H	DSS	methyl protons	internal	direct	1.0
¹⁵N	DSS	methyl protons	na	indirect	0.1013291

Referencing offset: -0.04 ppm, Outliers: 1 Detail

Protein Blocks Logo

Calculated from 20 models in PDB: 2MDR, Strand ID: A Detail

Release date

2014-05-05

Citation

A bimodular nuclear localization signal assembled via an extended double-stranded RNA-binding domain acts as an RNA-sensing signal for transportin 1
Barraud, P., Banerjee, S., Mohamed, W.I., Jantsch, M.F., Allain, F.
Proc. Natl. Acad. Sci. U. S. A. (2014), 111, E1852-E1861, PubMed 24753571 , DOI 10.1073/pnas.1323698111 , Abstract

Related entities 1. dsRBD3, : 1 : 2 : 11 entities Detail

Interaction partners 1. dsRBD3, : 60 interactors Detail

More details for 60 interactors identified by 14 citations

Experiments performed 14 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
12	dsRBD3	[U-99% 15N]	0.7 ~ 0.9 mM
13	sodium phosphate	natural abundance	20 mM
14	potassium chloride	natural abundance	100 mM
15	DTT	natural abundance	1 mM
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

2 2D 1H-13C HSQC aliphatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

3 2D 1H-13C HSQC aliphatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
7	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
8	sodium phosphate	natural abundance	20 mM
9	potassium chloride	natural abundance	100 mM
10	DTT	natural abundance	1 mM
11	D2O	natural abundance	100 %

4 3D HNCA

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

5 3D CBCA(CO)NH

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

6 3D HNCACB

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

7 3D HCCH-TOCSY

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
7	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
8	sodium phosphate	natural abundance	20 mM
9	potassium chloride	natural abundance	100 mM
10	DTT	natural abundance	1 mM
11	D2O	natural abundance	100 %

8 2D 1H-1H NOESY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
18	dsRBD3	natural abundance	0.7 ~ 0.9 mM
19	sodium phosphate	natural abundance	20 mM
20	potassium chloride	natural abundance	100 mM
21	DTT	natural abundance	1 mM
22	H2O	natural abundance	90 %
23	D2O	natural abundance	10 %

9 2D 1H-1H TOCSY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
18	dsRBD3	natural abundance	0.7 ~ 0.9 mM
19	sodium phosphate	natural abundance	20 mM
20	potassium chloride	natural abundance	100 mM
21	DTT	natural abundance	1 mM
22	H2O	natural abundance	90 %
23	D2O	natural abundance	10 %

10 3D 1H-15N NOESY

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
12	dsRBD3	[U-99% 15N]	0.7 ~ 0.9 mM
13	sodium phosphate	natural abundance	20 mM
14	potassium chloride	natural abundance	100 mM
15	DTT	natural abundance	1 mM
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

11 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

12 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
1	dsRBD3	[U-99% 13C; U-99% 15N]	0.7 ~ 0.9 mM
2	sodium phosphate	natural abundance	20 mM
3	potassium chloride	natural abundance	100 mM
4	DTT	natural abundance	1 mM
5	H2O	natural abundance	90 %
6	D2O	natural abundance	10 %

13 15N{1H}-HeteroNOE

Instrument

Bruker Avance - 600 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
12	dsRBD3	[U-99% 15N]	0.7 ~ 0.9 mM
13	sodium phosphate	natural abundance	20 mM
14	potassium chloride	natural abundance	100 mM
15	DTT	natural abundance	1 mM
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

14 long-range 2D 1H-15N HSQC

Instrument

Bruker Avance - 500 MHz

Sample

State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313.0 (±0.25) K, pH 7.0 (±0.2), Details pH 7.0

#	Name	Isotope labeling	Concentration
12	dsRBD3	[U-99% 15N]	0.7 ~ 0.9 mM
13	sodium phosphate	natural abundance	20 mM
14	potassium chloride	natural abundance	100 mM
15	DTT	natural abundance	1 mM
16	H2O	natural abundance	90 %
17	D2O	natural abundance	10 %

NMR combined restraints 4 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_19502_2mdr.nef
Input source #2: Coordindates	2mdr.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

-690-----700-------710-------720-------730-------740-------750-------760-------770-------780-------7
GSSHHHHHHSSGLVPRGSHMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAA
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
GSSHHHHHHSSGLVPRGSHMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAA
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100

90-------800-
LRVLIGENEKAER
|||||||||||||
LRVLIGENEKAER
-------110---

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	113	0	0	100.0

Content subtype: combined_19502_2mdr.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	891		77.9 (chain: A, length: 113)
1	Distance restraints	CNS/XPLOR_distance_constraints_2	Warning	3058 (1)	noe	76.1 (chain: A, length: 113)
2	Distance restraints	CNS/XPLOR_distance_constraints_3	OK	97 (1)	hbond	54.0 (chain: A, length: 113)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 113, Sequence coverage: 77.9%
- Total number of assignments
  - ¹H chemical shifts: 514
  - ¹³C chemical shifts: 284
  - ¹⁵N chemical shifts: 93
- Completeness of assignments
  - Entity_assemble_ID: A
- Redox state of CYS
- Peptide bond of PRO
- Tautomeric state of HIS
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Comp_index_ID	Comp_ID	Atom_ID	CS value (ppm)
738	HIS	ND1	195.886
738	HIS	NE2	203.215
754	HIS	ND1	241.401
754	HIS	NE2	171.497
775	HIS	ND1	201.998
775	HIS	NE2	198.172

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	682	514	75.4
¹³C chemical shifts	504	284	56.3
¹⁵N chemical shifts	122	87	71.3

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	231	175	75.8
¹³C chemical shifts	226	87	38.5
¹⁵N chemical shifts	106	79	74.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	451	339	75.2
¹³C chemical shifts	278	197	70.9
¹⁵N chemical shifts	16	8	50.0

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	52	45	86.5
¹³C chemical shifts	52	45	86.5

Atom group	# of target shifts	# of assigned shifts	Completeness (%)
¹H chemical shifts	58	44	75.9
¹³C chemical shifts	57	27	47.4
¹⁵N chemical shifts	1	1	100.0

Distance restraints

Saveframe: CNS/XPLOR_distance_constraints_2
- Status: Warning
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 113, Sequence coverage: 76.1%
- Total number of restraints: 3038
- Weight of restraints: 1.0 (3038)
- Potential type of restraints: square-well-parabolic (3038)
- Range of distance target values: 2.06, 4.03 (Å)
- Histogram of distance target values
- Histogram of discrepancy in distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map
- Saveframe: CNS/XPLOR_distance_constraints_3
  - Status: OK
  - Experiment type: hbond
  - Sequence coverage of experimental data
    - Entity_assembly_ID: A, Chain length: 113, Sequence coverage: 54.0%
  - Total number of restraints: 97
  - Weight of restraints: 1.0 (97)
  - Potential type of restraints: square-well-parabolic (97)
  - Range of distance target values: 2.0, 3.0 (Å)
  - Histogram of distance target values
  - Distance restraints per residue
    - Chain_ID: A
  - Distance restraints on contact map

Keywords ADAR, ADAR1, deaminase, dsRBD, dsRBM, Protein

Search

Query history

Resources

Search for primary databases

Search for subsidiary databases

Display

Hits per page

Statistics

Query Changes will take effect after "OK" button is selected.

Maximum hits

Default conjunction operator

Omni-box

Search filter

Sequence search (BLAST)

E-value

Query sequence coverage

Miscellaneous

The number of previewed publications

Completeness of assigned chemical shift

Sequence chart about top aligned regions

Sequence chart about interacting regions

Hit context with highlight

Link destinations for BMRB, PDB and EMDB

Found 1 Document (3.028 seconds)

BMRB: 19502

Sample #1

Sample #2

Sample #3

Sample #4

Chemical shift reference

Chemical shift reference

Chemical shift reference

Related entities 1. dsRBD3, : 1 : 2 : 11 entities Detail

Interaction partners 1. dsRBD3, : 60 interactors Detail

Experiments performed 14 experiments Detail

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

Instrument

Sample

NMR combined restraints 4 contents Detail