N-terminal domain of Bilbo1 from Trypanosoma brucei
MAFLVQVAAD IFNNKVNFEL SFPSRPSISE LTRSAETAFS NEISLRRPDN VPSHKFHSSK IKMYDEELNK WVDLIREDQL TDYCQLYVFQ PPNEWHKESQ KEIPPAMKPP
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 76.3 % (1032 of 1352) | 71.4 % (509 of 713) | 79.4 % (417 of 525) | 93.0 % (106 of 114) |
Backbone | 92.3 % (591 of 640) | 94.3 % (198 of 210) | 89.4 % (295 of 330) | 98.0 % (98 of 100) |
Sidechain | 65.7 % (540 of 822) | 61.8 % (311 of 503) | 72.5 % (221 of 305) | 57.1 % (8 of 14) |
Aromatic | 73.8 % (96 of 130) | 76.9 % (50 of 65) | 69.8 % (44 of 63) | 100.0 % (2 of 2) |
Methyl | 98.0 % (96 of 98) | 98.0 % (48 of 49) | 98.0 % (48 of 49) |
1. Bil NTD
MAFLVQVAAD IFNNKVNFEL SFPSRPSISE LTRSAETAFS NEISLRRPDN VPSHKFHSSK IKMYDEELNK WVDLIREDQL TDYCQLYVFQ PPNEWHKESQ KEIPPAMKPPSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | water | protons | 4.773 ppm | internal | indirect | 3.977 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13N | water | protons | 4.773 ppm | internal | indirect | 9.868 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | water | protons | 4.773 ppm | internal | indirect | 3.977 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13N | water | protons | 4.773 ppm | internal | indirect | 9.868 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | water | protons | 4.773 ppm | internal | indirect | 3.977 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13N | water | protons | 4.773 ppm | internal | indirect | 9.868 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
15C | water | protons | 4.773 ppm | internal | indirect | 3.977 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
13N | water | protons | 4.773 ppm | internal | indirect | 9.868 |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Varian Inova - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.8
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BILBO1-NTD | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | D2O | [U-2H] | 10 % | |
5 | H2O | natural abundance | 90 % | |
6 | sodium azide | natural abundance | 0.2 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19523_2mek.nef |
Input source #2: Coordindates | 2mek.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQ -------110 KEIPPAMKPP |||||||||| KEIPPAMKPP
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 110 | 0 | 0 | 100.0 |
Content subtype: combined_19523_2mek.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQ |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAFLVQVAADIFNNKVNFELSF...PSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 KEIPPAMKPP ||| |||| KEI.PAMK --------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
48 | PRO | N | 114.814 |
52 | PRO | N | 114.966 |
87 | TYR | HH | 8.7 |
91 | PRO | N | 115.026 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 713 | 491 | 68.9 |
13C chemical shifts | 525 | 409 | 77.9 |
15N chemical shifts | 119 | 104 | 87.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 210 | 195 | 92.9 |
13C chemical shifts | 220 | 193 | 87.7 |
15N chemical shifts | 100 | 97 | 97.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 503 | 296 | 58.8 |
13C chemical shifts | 305 | 216 | 70.8 |
15N chemical shifts | 19 | 7 | 36.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 51 | 98.1 |
13C chemical shifts | 52 | 51 | 98.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 47 | 72.3 |
13C chemical shifts | 63 | 42 | 66.7 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQ ||||||||||| ||||||||| ||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| |||||||| MAFLVQVAADI..NKVNFELSF....SISELTRSAETAFSNEISLRR.DNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQ..NEWHKESQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 KEIPPAMKPP ||| |||| KEI.PAMK --------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAFLVQVAADIFNNKVNFELSFPSRPSISELTRSAETAFSNEISLRRPDNVPSHKFHSSKIKMYDEELNKWVDLIREDQLTDYCQLYVFQPPNEWHKESQ ||||||||||| ||||||||||| ||||||||||||||||||||||| |||||||||||||||||||||||||||||||| |||||||| ||||| MAFLVQVAADI.NNKVNFELSFP..PSISELTRSAETAFSNEISLRRP.NVPSHKFHSSKIKMYDEELNKWVDLIREDQLT..CQLYVFQP....HKESQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110 KEIPPAMKPP |||||| ...PPAMKP ---------