Resonance assignment of RQC domain of human Bloom syndrome protein
CKTKDYKTRD VTDDVKSIVR FVQEHSSSQG MRNIKHVGPS GRFTMNMLVD IFLGSKSAKI QSGIFGKGSA YSRHNAERLF KKLILDKILD EDLYINANDQ AIAYVMLGNK AQTVLNGNLK VDFMETENSS SVKKQKALVA KVSQ
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 70.2 % (1193 of 1699) | 78.4 % (696 of 888) | 56.6 % (369 of 652) | 80.5 % (128 of 159) |
Backbone | 70.2 % (605 of 862) | 83.8 % (248 of 296) | 56.3 % (238 of 423) | 83.2 % (119 of 143) |
Sidechain | 71.1 % (691 of 972) | 75.7 % (448 of 592) | 64.3 % (234 of 364) | 56.3 % (9 of 16) |
Aromatic | 68.3 % (71 of 104) | 88.5 % (46 of 52) | 48.1 % (25 of 52) | |
Methyl | 84.8 % (134 of 158) | 91.1 % (72 of 79) | 78.5 % (62 of 79) |
1. BLM RQC
CKTKDYKTRD VTDDVKSIVR FVQEHSSSQG MRNIKHVGPS GRFTMNMLVD IFLGSKSAKI QSGIFGKGSA YSRHNAERLF KKLILDKILD EDLYINANDQ AIAYVMLGNK AQTVLNGNLK VDFMETENSS SVKKQKALVA KVSQSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Bruker Avance - 900 MHz equipped with a cryoprobe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 300 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | BLM RQC | [U-99% 13C; U-99% 15N] | protein | 0.8 mM |
2 | H2O | natural abundance | solvent | 90 % |
3 | D2O | natural abundance | solvent | 10 % |
4 | DTT | natural abundance | buffer | 1 mM |
5 | Tris | natural abundance | buffer | 20 mM |
6 | Sodium Chloride | natural abundance | salt | 100 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19530_2mh9.nef |
Input source #2: Coordindates | 2mh9.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ -------110-------120-------130-------140---- AIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQ |||||||||||||||||||||||||||||||||||||||||||| AIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQ
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 144 | 0 | 0 | 100.0 |
Content subtype: combined_19530_2mh9.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ ||||||||||||||||||||||||| ||| ||||||| ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ..TKDYKTRDVTDDVKSIVRFVQEHSS.QGM.NIKHVGP.GRFTMNMLVDIFLGS..AKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140---- AIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQ ||||||||||||||||||||||||||| AIAYVMLGNKAQTVLNGNLKVDFMETE -------110-------120-------
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
8 | THR | HG1 | 4.697 |
12 | THR | HG1 | 4.151 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 888 | 658 | 74.1 |
13C chemical shifts | 652 | 324 | 49.7 |
15N chemical shifts | 165 | 120 | 72.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 296 | 239 | 80.7 |
13C chemical shifts | 288 | 111 | 38.5 |
15N chemical shifts | 143 | 111 | 77.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 592 | 419 | 70.8 |
13C chemical shifts | 364 | 213 | 58.5 |
15N chemical shifts | 22 | 9 | 40.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 84 | 68 | 81.0 |
13C chemical shifts | 84 | 55 | 65.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 52 | 44 | 84.6 |
13C chemical shifts | 52 | 22 | 42.3 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ ||||||||||||||||||||||||| ||| ||||||| ||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||| ..TKDYKTRDVTDDVKSIVRFVQEHSS.QGM.NIKHVGP.GRFTMNMLVDIFLGS..AKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140---- AIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQ ||||||||||||||||||||||||||| AIAYVMLGNKAQTVLNGNLKVDFMETE -------110-------120-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 CKTKDYKTRDVTDDVKSIVRFVQEHSSSQGMRNIKHVGPSGRFTMNMLVDIFLGSKSAKIQSGIFGKGSAYSRHNAERLFKKLILDKILDEDLYINANDQ |||||||||||||||||||| |||| ||||||||||||||||||| ||| |||||||||||||||||||||||||||||||| ......KTRDVTDDVKSIVRFVQEHS...GMRN........RFTMNMLVDIFLGSKSAKI...IFG..SAYSRHNAERLFKKLILDKILDEDLYINANDQ --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140---- AIAYVMLGNKAQTVLNGNLKVDFMETENSSSVKKQKALVAKVSQ ||||||||||||||||||||||||||| AIAYVMLGNKAQTVLNGNLKVDFMETE -------110-------120-------