Solution Structure of NusE (S10) from Thermotoga maritima
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 85.5 % (827 of 967) | 84.3 % (429 of 509) | 86.3 % (327 of 379) | 89.9 % (71 of 79) |
Backbone | 90.2 % (433 of 480) | 90.7 % (147 of 162) | 90.1 % (218 of 242) | 89.5 % (68 of 76) |
Sidechain | 82.8 % (468 of 565) | 81.3 % (282 of 347) | 85.1 % (183 of 215) | 100.0 % (3 of 3) |
Aromatic | 56.3 % (9 of 16) | 87.5 % (7 of 8) | 25.0 % (2 of 8) | |
Methyl | 84.8 % (95 of 112) | 89.3 % (50 of 56) | 80.4 % (45 of 56) |
1. entity
SMGGQKIRIK LKAYDHELLD ESAKKIVEVA KSTNSKVSGP IPLPTESRVH KRLIDIIDPS PKTIDALMRI NLPAGVDVEI KLSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Bruker Avance - 800 MHz equipped with CryoProbe
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 323 K, pH 7.5, Details 25 mM HEPES, 50 mM NaCl, pH 7.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | HEPES | natural abundance | 25 mM | |
3 | sodium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19533_2mew.nef |
Input source #2: Coordindates | 2mew.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80-- SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 82 | 0 | 0 | 100.0 |
Content subtype: combined_19533_2mew.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80-- SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL | ||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||| S.GGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPT..RVHKRLIDIIDPSPKTIDALMRINLPAGVDVE --------10--------20--------30--------40--------50--------60--------70---------
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 509 | 418 | 82.1 |
13C chemical shifts | 379 | 316 | 83.4 |
15N chemical shifts | 83 | 68 | 81.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 162 | 144 | 88.9 |
13C chemical shifts | 164 | 140 | 85.4 |
15N chemical shifts | 76 | 65 | 85.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 347 | 274 | 79.0 |
13C chemical shifts | 215 | 176 | 81.9 |
15N chemical shifts | 7 | 3 | 42.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 58 | 49 | 84.5 |
13C chemical shifts | 58 | 44 | 75.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 8 | 6 | 75.0 |
13C chemical shifts | 8 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80-- SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL ||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| ..GGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPT.SRVHKRLIDIIDPSPKTIDALMRINLPAGVDVE --------10--------20--------30--------40--------50--------60--------70---------
--------10--------20--------30--------40--------50--------60--------70--------80-- SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL | | ||| | ||||||||||||||| | | | | | ||||||||| ||||||||||| | ......I.I.LKA..H.LLDESAKKIVEVAKS...K.S..I.L..E..VHKRLIDII..SPKTIDALMRI......D --------10--------20--------30--------40--------50--------60--------70-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80-- SMGGQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPTESRVHKRLIDIIDPSPKTIDALMRINLPAGVDVEIKL |||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||| ...GQKIRIKLKAYDHELLDESAKKIVEVAKSTNSKVSGPIPLPT....HKRLIDIIDPSPKTIDALMRINLPAGVDVEI --------10--------20--------30--------40--------50--------60--------70--------80