SGTX-Sf1a
ID | Type | Value order | Atom ID 1 | Atom ID 2 |
---|---|---|---|---|
1 | disulfide | sing | 1:CYS4:SG | 1:CYS20:SG |
2 | disulfide | sing | 1:CYS11:SG | 1:CYS23:SG |
3 | disulfide | sing | 1:CYS19:SG | 1:CYS43:SG |
4 | disulfide | sing | 1:CYS25:SG | 1:CYS41:SG |
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.8 % (477 of 493) | 96.5 % (247 of 256) | 96.8 % (182 of 188) | 98.0 % (48 of 49) |
Backbone | 97.1 % (268 of 276) | 96.9 % (93 of 96) | 97.1 % (132 of 136) | 97.7 % (43 of 44) |
Sidechain | 96.9 % (251 of 259) | 96.2 % (154 of 160) | 97.9 % (92 of 94) | 100.0 % (5 of 5) |
Aromatic | 92.9 % (26 of 28) | 100.0 % (14 of 14) | 84.6 % (11 of 13) | 100.0 % (1 of 1) |
Methyl | 100.0 % (28 of 28) | 100.0 % (14 of 14) | 100.0 % (14 of 14) |
1. SF1A
SKECMTDGTV CYIHNHNDCC GSCLCSNGPI ARPWEMMVGN CMCGPKASolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.781 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.781 ppm | internal | direct | 1.0 |
15N | water | protons | 4.781 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.781 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.781 ppm | internal | direct | 1.0 |
15N | water | protons | 4.781 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.781 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.781 ppm | internal | direct | 1.0 |
15N | water | protons | 4.781 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.781 ppm | na | indirect | 0.2514495 |
1H | water | protons | 4.781 ppm | internal | direct | 1.0 |
15N | water | protons | 4.781 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 313 K, pH 3.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SF1A | [U-99% 13C; U-99% 15N] | 0.42 mM | |
2 | D2O | [U-100% 2H] | 5 % | |
3 | Sodium citrate | natural abundance | 20 mM | |
4 | H2O | natural abundance | 95 % | |
5 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19535_2mf3.nef |
Input source #2: Coordindates | 2mf3.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Å) |
---|---|---|---|---|
A:4:CYS:SG | A:20:CYS:SG | oxidized, CA 54.15, CB 42.39 ppm | oxidized, CA 57.344, CB 39.211 ppm | 2.121 |
A:11:CYS:SG | A:23:CYS:SG | oxidized, CA 53.788, CB 49.168 ppm | oxidized, CA 55.865, CB 39.214 ppm | 1.98 |
A:19:CYS:SG | A:43:CYS:SG | oxidized, CA 55.126, CB 36.169 ppm | oxidized, CA 53.494, CB 35.707 ppm | 2.123 |
A:25:CYS:SG | A:41:CYS:SG | oxidized, CA 54.567, CB 45.295 ppm | oxidized, CA 56.317, CB 48.409 ppm | 2.12 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40------- SKECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA ||||||||||||||||||||||||||||||||||||||||||||||| SKECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 47 | 0 | 0 | 100.0 |
Content subtype: combined_19535_2mf3.nef
Assigned chemical shifts
--------10--------20--------30--------40------- SKECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA ||||||||||||||||||||||||||||||||||||||||||||||| SKECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 256 | 255 | 99.6 |
13C chemical shifts | 188 | 182 | 96.8 |
15N chemical shifts | 50 | 49 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 96 | 95 | 99.0 |
13C chemical shifts | 94 | 90 | 95.7 |
15N chemical shifts | 44 | 43 | 97.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 160 | 160 | 100.0 |
13C chemical shifts | 94 | 92 | 97.9 |
15N chemical shifts | 6 | 6 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 18 | 18 | 100.0 |
13C chemical shifts | 18 | 18 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 14 | 14 | 100.0 |
13C chemical shifts | 13 | 11 | 84.6 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40------- SKECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA ||||||||||||||||||||||||||||||||||||||||||||||| SKECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA