Domain 1 of E. coli ribosomal protein S1
GIDPFTESLK EIETRPGSIV RGVVVAIDKD VVLVDAGLKS ESAIPAEQFK NAQGELEIQV GDEVDVALDA VEDGFGETLL SREKAKRHEA WITLEK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 94.5 % (1020 of 1079) | 94.4 % (526 of 557) | 93.9 % (398 of 424) | 98.0 % (96 of 98) |
Backbone | 96.3 % (549 of 570) | 96.4 % (190 of 197) | 95.7 % (268 of 280) | 97.8 % (91 of 93) |
Sidechain | 93.0 % (555 of 597) | 93.3 % (336 of 360) | 92.2 % (214 of 232) | 100.0 % (5 of 5) |
Aromatic | 100.0 % (46 of 46) | 100.0 % (23 of 23) | 100.0 % (22 of 22) | 100.0 % (1 of 1) |
Methyl | 95.4 % (124 of 130) | 96.9 % (63 of 65) | 93.8 % (61 of 65) |
1. S1F1
GIDPFTESLK EIETRPGSIV RGVVVAIDKD VVLVDAGLKS ESAIPAEQFK NAQGELEIQV GDEVDVALDA VEDGFGETLL SREKAKRHEA WITLEKSolvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 950 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
2 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
3 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
4 | H2O | natural abundance | 93 % | |
5 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
10 | S1F1 | [U-99% 13C; U-99% 15N] | 0.5 (±2.0E-5) mM | |
11 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
12 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | [U-100% 2H] | 7 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Bruker Avance - 950 MHz
State isotropic, Solvent system 100% D2O, Pressure 1.000 (±0.01) atm, Temperature 293.000 (±0.50) K, pH 6.500 (±0.10)
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | S1F1 | [U-99% 13C; U-99% 15N] | 0.2 (±2.0E-5) mM | |
7 | potassium phosphate | natural abundance | 25.0 (±0.0025) mM | |
8 | potassium chloride | natural abundance | 200.0 (±0.0025) mM | |
9 | D2O | [U-100% 2H] | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19550_2mfi.nef |
Input source #2: Coordindates | 2mfi.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
----10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEK --------10--------20--------30--------40--------50--------60--------70--------80--------90------
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 96 | 0 | 0 | 100.0 |
Content subtype: combined_19550_2mfi.nef
Assigned chemical shifts
----10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||| GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLS.EKAKRHEAWITLEK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 557 | 533 | 95.7 |
13C chemical shifts | 424 | 389 | 91.7 |
15N chemical shifts | 102 | 95 | 93.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 197 | 193 | 98.0 |
13C chemical shifts | 192 | 179 | 93.2 |
15N chemical shifts | 93 | 90 | 96.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 360 | 340 | 94.4 |
13C chemical shifts | 232 | 210 | 90.5 |
15N chemical shifts | 9 | 5 | 55.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 65 | 63 | 96.9 |
13C chemical shifts | 65 | 61 | 93.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 23 | 23 | 100.0 |
13C chemical shifts | 22 | 22 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
----10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GIDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLSREKAKRHEAWITLEK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||| .IDPFTESLKEIETRPGSIVRGVVVAIDKDVVLVDAGLKSESAIPAEQFKNAQGELEIQVGDEVDVALDAVEDGFGETLLS.EKAKRHEAWITLEK