The C-terminal domain of SRA1p has a fold more similar to PRP18 than to an RRM and does not directly bind to the SRA1 RNA STR7 region.
GSEAVMEDVL RPLEQALEDC RGHTRKQVCD DISRRLALLQ EQWAGGKLSI PVKKRMALLV QELSSHRWDA ADDIHRSLMV DHVTEVSQWM VGVKRLIAEK RSLFSEEAAN EEKSAATAEK NHTIPGFQQA S
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 89.3 % (1345 of 1507) | 84.5 % (665 of 787) | 94.3 % (546 of 579) | 95.0 % (134 of 141) |
Backbone | 99.1 % (773 of 780) | 98.9 % (262 of 265) | 99.2 % (384 of 387) | 99.2 % (127 of 128) |
Sidechain | 81.7 % (696 of 852) | 77.2 % (403 of 522) | 90.2 % (286 of 317) | 53.8 % (7 of 13) |
Aromatic | 75.0 % (57 of 76) | 73.7 % (28 of 38) | 74.3 % (26 of 35) | 100.0 % (3 of 3) |
Methyl | 95.3 % (141 of 148) | 95.9 % (71 of 74) | 94.6 % (70 of 74) |
1. SRA1p C-terminal domain
GSEAVMEDVL RPLEQALEDC RGHTRKQVCD DISRRLALLQ EQWAGGKLSI PVKKRMALLV QELSSHRWDA ADDIHRSLMV DHVTEVSQWM VGVKRLIAEK RSLFSEEAAN EEKSAATAEK NHTIPGFQQA SSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State anisotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DTT | natural abundance | 2 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
11 | D2O | natural abundance | 100 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 273 K, pH 7.4
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | sodium phosphate | natural abundance | 50 mM | |
2 | DTT | natural abundance | 2 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | SRA1p C-terminal domain | [U-98% 13C; U-98% 15N] | 0.6 mM | |
5 | H2O | natural abundance | 95 % | |
6 | D2O | natural abundance | 5 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19607_2mgx.nef |
Input source #2: Coordindates | 2mgx.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--110-------120-------130-------140-------150-------160-------170-------180-------190-------200----- GSEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --210-------220-------230------ RSLFSEEAANEEKSAATAEKNHTIPGFQQAS ||||||||||||||||||||||||||||||| RSLFSEEAANEEKSAATAEKNHTIPGFQQAS -------110-------120-------130-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 131 | 0 | 0 | 100.0 |
Content subtype: combined_19607_2mgx.nef
Assigned chemical shifts
--110-------120-------130-------140-------150-------160-------170-------180-------190-------200----- GSEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK --210-------220-------230------ RSLFSEEAANEEKSAATAEKNHTIPGFQQAS ||||||||||||||||||||| ||||||||| RSLFSEEAANEEKSAATAEKN.TIPGFQQAS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
128 | HIS | HD1 | 6.977 |
171 | HIS | HD1 | 6.866 |
180 | HIS | HD1 | 6.692 |
187 | HIS | HD1 | 6.681 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 787 | 641 | 81.4 |
13C chemical shifts | 579 | 536 | 92.6 |
15N chemical shifts | 151 | 130 | 86.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 265 | 256 | 96.6 |
13C chemical shifts | 262 | 258 | 98.5 |
15N chemical shifts | 128 | 123 | 96.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 522 | 385 | 73.8 |
13C chemical shifts | 317 | 278 | 87.7 |
15N chemical shifts | 23 | 7 | 30.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 72 | 92.3 |
13C chemical shifts | 78 | 72 | 92.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 38 | 28 | 73.7 |
13C chemical shifts | 35 | 26 | 74.3 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--110-------120-------130-------140-------150-------160-------170-------180-------190-------200----- GSEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK --210-------220-------230------ RSLFSEEAANEEKSAATAEKNHTIPGFQQAS ||||||||||||||||||||| ||||||||| RSLFSEEAANEEKSAATAEKN.TIPGFQQAS
Dihedral angle restraints
--110-------120-------130-------140-------150-------160-------170-------180-------190-------200----- GSEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| ..EAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMV........WMVGVKRLIAEK --110-------120-------130-------140-------150-------160-------170-------180-------190-------200----- --210-------220-------230------ RSLFSEEAANEEKSAATAEKNHTIPGFQQAS ||||||| RSLFSEE --210--