Solution structure of the mitochondrial translocator protein (TSPO) in complex with its high-affinity ligand PK11195
MPESWVPAVG LTLVPSLGGF MGAYFVRGEG LRWYAGLQKP SWHPPRWTLA PIWGTLYSAM GYGSYIVWKE LGGFTEDAMV PLGLYTGQLA LNWAWPPIFF GARQMGWALA DLLLVSGVAT ATTLAWHRVS PPAARLLYPY LAWLAFATVL NYYVWRDNSG RRGGSRLAE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.9 % (1867 of 1989) | 94.3 % (957 of 1015) | 92.6 % (741 of 800) | 97.1 % (169 of 174) |
Backbone | 96.8 % (956 of 988) | 98.0 % (338 of 345) | 95.9 % (467 of 487) | 96.8 % (151 of 156) |
Sidechain | 91.1 % (1048 of 1150) | 91.6 % (614 of 670) | 90.0 % (416 of 462) | 100.0 % (18 of 18) |
Aromatic | 73.6 % (215 of 292) | 74.7 % (109 of 146) | 70.1 % (94 of 134) | 100.0 % (12 of 12) |
Methyl | 98.1 % (202 of 206) | 98.1 % (101 of 103) | 98.1 % (101 of 103) |
1. entity 1
MPESWVPAVG LTLVPSLGGF MGAYFVRGEG LRWYAGLQKP SWHPPRWTLA PIWGTLYSAM GYGSYIVWKE LGGFTEDAMV PLGLYTGQLA LNWAWPPIFF GARQMGWALA DLLLVSGVAT ATTLAWHRVS PPAARLLYPY LAWLAFATVL NYYVWRDNSG RRGGSRLAESolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | entity_1 | [U-2H,15N; Idelta1/Leu,ValproS-13CH3] | 0.5 mM | |
25 | PKA | natural abundance | 2.9 mM | |
26 | sodium phosphate buffer | natural abundance | 10 mM | |
27 | DPC micelles | [U-100% 2H] | 60 mM | |
28 | H2O | natural abundance | 90 % | |
29 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | PKA | natural abundance | 2.9 mM | |
3 | sodium phosphate buffer | natural abundance | 10 mM | |
4 | DPC micelles | [U-100% 2H] | 60 mM | |
5 | H2O | natural abundance | 90 % | |
6 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | entity_1 | [U-2H,15N; Idelta1/Leu,ValproS-13CH3] | 0.5 mM | |
25 | PKA | natural abundance | 2.9 mM | |
26 | sodium phosphate buffer | natural abundance | 10 mM | |
27 | DPC micelles | [U-100% 2H] | 60 mM | |
28 | H2O | natural abundance | 90 % | |
29 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | entity_1 | [U-2H,15N; Idelta1/Leu,ValproS-13CH3] | 0.5 mM | |
25 | PKA | natural abundance | 2.9 mM | |
26 | sodium phosphate buffer | natural abundance | 10 mM | |
27 | DPC micelles | [U-100% 2H] | 60 mM | |
28 | H2O | natural abundance | 90 % | |
29 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
12 | entity_1 | [U-13C; U-15N; U-2H] | 0.8 mM | |
13 | PKA | natural abundance | 2.9 mM | |
14 | sodium phosphate buffer | natural abundance | 10 mM | |
15 | DPC micelles | [U-100% 2H] | 60 mM | |
16 | H2O | natural abundance | 90 % | |
17 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
24 | entity_1 | [U-2H,15N; Idelta1/Leu,ValproS-13CH3] | 0.5 mM | |
25 | PKA | natural abundance | 2.9 mM | |
26 | sodium phosphate buffer | natural abundance | 10 mM | |
27 | DPC micelles | [U-100% 2H] | 60 mM | |
28 | H2O | natural abundance | 90 % | |
29 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
36 | entity_1 | [U-2H; U-1H,15N-Leu,Phe] | 0.5 mM | |
37 | PKA | natural abundance | 2.9 mM | |
38 | sodium phosphate buffer | natural abundance | 10 mM | |
39 | DPC micelles | [U-100% 2H] | 60 mM | |
40 | H2O | natural abundance | 93 % | |
41 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | entity_1 | [U-100% 13C; U-100% 15N] | 0.9 mM | |
8 | PKA | natural abundance | 2.9 mM | |
9 | sodium phosphate buffer | natural abundance | 10 mM | |
10 | DPC micelles | [U-2H] | 60 mM | |
11 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
18 | entity_1 | [U-2H; U-1H, 15N,13C-TRP, ARG] | 0.5 mM | |
19 | PKA | natural abundance | 2.9 mM | |
20 | sodium phosphate buffer | natural abundance | 10 mM | |
21 | DPC micelles | [U-100% 2H] | 60 mM | |
22 | H2O | natural abundance | 90 % | |
23 | D2O | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 315 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
30 | entity_1 | [U-2H; U-1H, 15N,13C-Ile,Lys,Pro,Gly] | 0.5 mM | |
31 | PKA | natural abundance | 2.9 mM | |
32 | sodium phosphate buffer | natural abundance | 10 mM | |
33 | DPC micelles | [U-100% 2H] | 60 mM | |
34 | H2O | natural abundance | 90 % | |
35 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19608_2mgy.nef |
Input source #2: Coordindates | 2mgy.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | PKA | N-[(2R)-butan-2-yl]-1-(2-chlorophenyl)-N-methylisoquinoline-3-carboxamide | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFF |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFF -------110-------120-------130-------140-------150-------160--------- GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 169 | 0 | 0 | 100.0 |
Content subtype: combined_19608_2mgy.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAW.PIFF -------110-------120-------130-------140-------150-------160--------- GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 800 | 316 | 39.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 338 | 168 | 49.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 462 | 148 | 32.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 108 | 20 | 18.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 134 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFF ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||| MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAW.PIFF -------110-------120-------130-------140-------150-------160--------- GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYAGLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFF |||||||||||||||||||| | || || | || ||||||||||||||||||||||||| |||||||||||||||||| | ....WVPAVGLTLVPSLGGFMGAY..R.EG..WY..L.......PR.TLAPIWGTLYSAMGYGSYIVWKELG.....AMVPLGLYTGQLALNWAW..I.. --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140-------150-------160--------- GARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLAE | ||||||||||||||||||| | || || |||||||||||||||||| .A.....ALADLLLVSGVATATTLAW...S..AA..LY.YLAWLAFATVLNYYVWRD -------110-------120-------130-------140-------150-------