1H, 15N and 13C resonance assignment of a transport protein
MFDIGFSELL LVFIIGLVVL GPQRLPVAVK TVAGWIRALR SLATTVQNEL TQELKLQEFQ DSLKKVEKAS LTNLTPELKA SMDELRQAAE SMKRSYVAND PLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 90.3 % (1173 of 1299) | 88.9 % (598 of 673) | 90.8 % (464 of 511) | 96.5 % (111 of 115) |
Backbone | 93.8 % (606 of 646) | 94.0 % (205 of 218) | 92.9 % (300 of 323) | 96.2 % (101 of 105) |
Sidechain | 87.9 % (666 of 758) | 86.4 % (393 of 455) | 89.8 % (263 of 293) | 100.0 % (10 of 10) |
Aromatic | 69.0 % (58 of 84) | 69.0 % (29 of 42) | 68.3 % (28 of 41) | 100.0 % (1 of 1) |
Methyl | 91.3 % (137 of 150) | 92.0 % (69 of 75) | 90.7 % (68 of 75) |
1. protein
MFDIGFSELL LVFIIGLVVL GPQRLPVAVK TVAGWIRALR SLATTVQNEL TQELKLQEFQ DSLKKVEKAS LTNLTPELKA SMDELRQAAE SMKRSYVAND PLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 313 K, pH 5.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | sodium acetate | natural abundance | 20 mM | |
3 | DPC | natural abundance | 40 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19618_2mi2.nef |
Input source #2: Coordindates | 2mi2.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND --------- PLEHHHHHH ||||||||| PLEHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 109 | 0 | 0 | 100.0 |
Content subtype: combined_19618_2mi2.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- PLEHHHHHH ||||| PLEHH -----
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
44 | THR | HG1 | 4.644 |
62 | SER | HG | 4.66 |
72 | THR | HG1 | 4.655 |
81 | SER | HG | 4.676 |
91 | SER | HG | 4.664 |
95 | SER | HG | 4.642 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 673 | 596 | 88.6 |
13C chemical shifts | 511 | 469 | 91.8 |
15N chemical shifts | 120 | 116 | 96.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 218 | 208 | 95.4 |
13C chemical shifts | 218 | 204 | 93.6 |
15N chemical shifts | 105 | 101 | 96.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 455 | 388 | 85.3 |
13C chemical shifts | 293 | 265 | 90.4 |
15N chemical shifts | 15 | 15 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 75 | 96.2 |
13C chemical shifts | 78 | 73 | 93.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 42 | 27 | 64.3 |
13C chemical shifts | 41 | 26 | 63.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- PLEHHHHHH |||| PLEH ----
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --------- PLEHHHHHH ||| PLE ---
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND ||||||||||| ||| ||||||||||||||||||||| ||||||||||||||||| |||||||||||||||||||| .....FSELLLVFIIG.VVL.....PVAVKTVAGWIRALRSLATTV.........LQEFQDSLKKVEKASLT....ELKASMDELRQAAESMKRSY --------10--------20--------30--------40--------50--------60--------70--------80--------90------ --------- PLEHHHHHH
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQDSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVAND ||||||||||||||| ||||||||||||||||||||||| |||||||||||||||||| |||||||||||||||||||||| .....FSELLLVFIIGLVVL...RLPVAVKTVAGWIRALRSLATTV........KLQEFQDSLKKVEKASLT...PELKASMDELRQAAESMKRSYV --------10--------20--------30--------40--------50--------60--------70--------80--------90------- --------- PLEHHHHHH