Solution structure of the major factor VIII binding region on von Willebrand factor
GAMGSCRPPM VKLVCPADNL RAEGLECTKT CQNYDLECMS MGCVSGCLCP PGMVRHENRC VALERCPCFH QGKEYAPGET VKIGCNTCVC RDRKWNCTDH VCD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 82.1 % (917 of 1117) | 87.9 % (514 of 585) | 73.1 % (313 of 428) | 86.5 % (90 of 104) |
Backbone | 75.5 % (456 of 604) | 86.1 % (179 of 208) | 65.0 % (195 of 300) | 85.4 % (82 of 96) |
Sidechain | 90.3 % (548 of 607) | 88.9 % (335 of 377) | 92.3 % (205 of 222) | 100.0 % (8 of 8) |
Aromatic | 100.0 % (50 of 50) | 100.0 % (25 of 25) | 100.0 % (24 of 24) | 100.0 % (1 of 1) |
Methyl | 98.8 % (79 of 80) | 97.5 % (39 of 40) | 100.0 % (40 of 40) |
1. VWF TIL-E
GAMGSCRPPM VKLVCPADNL RAEGLECTKT CQNYDLECMS MGCVSGCLCP PGMVRHENRC VALERCPCFH QGKEYAPGET VKIGCNTCVC RDRKWNCTDH VCDSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details Partially 13C-labelled sample for stereospecific methyl assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VWF TIL-E | [U-10% 13C] | 300 (±100.0) mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for 13C NOESY at 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation dispersion at 500 and 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
22 | sodium phosphate | natural abundance | 20 mM | |
23 | sodium chloride | natural abundance | 100 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for isotropic splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
27 | sodium phosphate | natural abundance | 20 mM | |
28 | sodium chloride | natural abundance | 100 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in phage for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
32 | sodium phosphate | natural abundance | 20 mM | |
33 | sodium chloride | natural abundance | 100 mM | |
34 | Pf1 phage | natural abundance | 5 (±1.0) mg/mL | |
35 | H2O | natural abundance | 90 % | |
36 | D2O | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in PEG for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
37 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
38 | sodium phosphate | natural abundance | 20 mM | |
39 | sodium chloride | natural abundance | 100 mM | |
40 | pentaethylene glycol dodecyl ether | natural abundance | 2 (±0.2) % w/v | |
41 | n-hexanol | natural abundance | 50 (±5.0) mM | |
42 | H2O | natural abundance | 90 % | |
43 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.773 ppm | internal | indirect | 0.2514495 |
1H | water | protons | 4.773 ppm | internal | direct | 1.0 |
15N | water | protons | 4.773 ppm | internal | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details Partially 13C-labelled sample for stereospecific methyl assignment
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | VWF TIL-E | [U-10% 13C] | 300 (±100.0) mM | |
7 | sodium phosphate | natural abundance | 20 mM | |
8 | sodium chloride | natural abundance | 100 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for 13C NOESY at 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
11 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
12 | sodium phosphate | natural abundance | 20 mM | |
13 | sodium chloride | natural abundance | 100 mM | |
14 | H2O | natural abundance | 90 % | |
15 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation dispersion at 500 and 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
22 | sodium phosphate | natural abundance | 20 mM | |
23 | sodium chloride | natural abundance | 100 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Bruker Avance III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 15N sample for relaxation dispersion at 500 and 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
21 | VWF TIL-E | [U-15N] | 300 (±100.0) mM | |
22 | sodium phosphate | natural abundance | 20 mM | |
23 | sodium chloride | natural abundance | 100 mM | |
24 | H2O | natural abundance | 90 % | |
25 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for isotropic splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
27 | sodium phosphate | natural abundance | 20 mM | |
28 | sodium chloride | natural abundance | 100 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in phage for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
31 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
32 | sodium phosphate | natural abundance | 20 mM | |
33 | sodium chloride | natural abundance | 100 mM | |
34 | Pf1 phage | natural abundance | 5 (±1.0) mg/mL | |
35 | H2O | natural abundance | 90 % | |
36 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in PEG for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
37 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
38 | sodium phosphate | natural abundance | 20 mM | |
39 | sodium chloride | natural abundance | 100 mM | |
40 | pentaethylene glycol dodecyl ether | natural abundance | 2 (±0.2) % w/v | |
41 | n-hexanol | natural abundance | 50 (±5.0) mM | |
42 | H2O | natural abundance | 90 % | |
43 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for isotropic splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
27 | sodium phosphate | natural abundance | 20 mM | |
28 | sodium chloride | natural abundance | 100 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in PEG for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
37 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
38 | sodium phosphate | natural abundance | 20 mM | |
39 | sodium chloride | natural abundance | 100 mM | |
40 | pentaethylene glycol dodecyl ether | natural abundance | 2 (±0.2) % w/v | |
41 | n-hexanol | natural abundance | 50 (±5.0) mM | |
42 | H2O | natural abundance | 90 % | |
43 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for isotropic splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
27 | sodium phosphate | natural abundance | 20 mM | |
28 | sodium chloride | natural abundance | 100 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in PEG for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
37 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
38 | sodium phosphate | natural abundance | 20 mM | |
39 | sodium chloride | natural abundance | 100 mM | |
40 | pentaethylene glycol dodecyl ether | natural abundance | 2 (±0.2) % w/v | |
41 | n-hexanol | natural abundance | 50 (±5.0) mM | |
42 | H2O | natural abundance | 90 % | |
43 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for isotropic splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
27 | sodium phosphate | natural abundance | 20 mM | |
28 | sodium chloride | natural abundance | 100 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in PEG for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
37 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
38 | sodium phosphate | natural abundance | 20 mM | |
39 | sodium chloride | natural abundance | 100 mM | |
40 | pentaethylene glycol dodecyl ether | natural abundance | 2 (±0.2) % w/v | |
41 | n-hexanol | natural abundance | 50 (±5.0) mM | |
42 | H2O | natural abundance | 90 % | |
43 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for isotropic splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
26 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
27 | sodium phosphate | natural abundance | 20 mM | |
28 | sodium chloride | natural abundance | 100 mM | |
29 | H2O | natural abundance | 90 % | |
30 | D2O | natural abundance | 10 % |
Bruker Avance III - 500 MHz
State anisotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample in PEG for aligned splittings at 500 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
37 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
38 | sodium phosphate | natural abundance | 20 mM | |
39 | sodium chloride | natural abundance | 100 mM | |
40 | pentaethylene glycol dodecyl ether | natural abundance | 2 (±0.2) % w/v | |
41 | n-hexanol | natural abundance | 50 (±5.0) mM | |
42 | H2O | natural abundance | 90 % | |
43 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for assignment and 15N-NOESY at 600 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | natural abundance | 10 % |
Bruker Avance III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for 13C NOESY at 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Bruker Avance III - 700 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.4, Details 13C/15N sample for 13C NOESY at 700 MHz
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
16 | VWF TIL-E | [U-13C; U-15N] | 300 (±100.0) mM | |
17 | sodium phosphate | natural abundance | 20 mM | |
18 | sodium chloride | natural abundance | 100 mM | |
19 | H2O | natural abundance | 90 % | |
20 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_19646_2mhp.nef |
Input source #2: Coordindates | 2mhp.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | True (see coordinates for details) |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
Ptnr_site_1 | Ptnr_site_2 | Redox_state_prediction_1 | Redox_state_prediction_2 | Distance (Ã…) |
---|---|---|---|---|
A:6:CYS:SG | A:47:CYS:SG | unknown | oxidized, CA 54.413, CB 41.276 ppm | 2.02 |
A:15:CYS:SG | A:43:CYS:SG | oxidized, CA 56.014, CB 40.082 ppm | oxidized, CB 38.6 ppm | 2.023 |
A:27:CYS:SG | A:38:CYS:SG | unknown | unknown | 2.019 |
A:31:CYS:SG | A:66:CYS:SG | oxidized, CA 57.48, CB 36.316 ppm | oxidized, CA 55.125, CB 37.198 ppm | 2.014 |
A:49:CYS:SG | A:60:CYS:SG | oxidized, CA 54.09, CB 36.633 ppm | oxidized, CA 53.98, CB 40.976 ppm | 2.02 |
A:68:CYS:SG | A:90:CYS:SG | oxidized, CA 56.386, CB 42.435 ppm | oxidized, CA 54.727, CB 36.915 ppm | 2.004 |
A:85:CYS:SG | A:102:CYS:SG | oxidized, CA 58.558, CB 37.971 ppm | oxidized, CA 52.964, CB 37.591 ppm | 2.021 |
A:88:CYS:SG | A:97:CYS:SG | oxidized, CA 54.867, CB 50.459 ppm | oxidized, CA 55.808, CB 47.903 ppm | 2.024 |
Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH --- VCD ||| VCD
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 103 | 0 | 0 | 100.0 |
Content subtype: combined_19646_2mhp.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH || | |||||||||||||||| || |||||||||| ||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| .AM..C.PPMVKLVCPADNLRAE.LE.TKTCQNYDLE.MSMGCVSGCLC..GMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH --- VCD ||| VCD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 585 | 501 | 85.6 |
13C chemical shifts | 428 | 287 | 67.1 |
15N chemical shifts | 111 | 85 | 76.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 208 | 174 | 83.7 |
13C chemical shifts | 206 | 90 | 43.7 |
15N chemical shifts | 96 | 77 | 80.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 377 | 327 | 86.7 |
13C chemical shifts | 222 | 197 | 88.7 |
15N chemical shifts | 15 | 8 | 53.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 43 | 95.6 |
13C chemical shifts | 45 | 43 | 95.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 25 | 25 | 100.0 |
13C chemical shifts | 24 | 24 | 100.0 |
15N chemical shifts | 1 | 1 | 100.0 |
Covalent bonds
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH || ||||||||||||||| |||||||||| |||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| .AM.....PMVKLVCPADNLRAE....TKTCQNYDLE.MSMGCVSGCLCP.GMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH --- VCD ||| VCD
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH |||||||||||||||| |||||||||||| ||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| ......RPPMVKLVCPADNLRA.....TKTCQNYDLECM...CVSGCLC..GMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 --- VCD | V -
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GAMGSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCRDRKWNCTDH ||||||| ||||||||| ||||| |||||||||||||||||||||||| ||||||| ||||||||||||| ........PMVKLVC............TKTCQNYDL.......VSGCL...GMVRHENRCVALERCPCFHQGKEY.PGETVKI..NTCVCRDRKWNCT --------10--------20--------30--------40--------50--------60--------70--------80--------90-------- --- VCD