Solution structure of the extracellular sensor domain of DraK histidine kinase
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 96.0 % (940 of 979) | 96.4 % (489 of 507) | 94.8 % (362 of 382) | 98.9 % (89 of 90) |
Backbone | 97.6 % (519 of 532) | 97.3 % (180 of 185) | 97.3 % (254 of 261) | 98.8 % (85 of 86) |
Sidechain | 94.9 % (501 of 528) | 96.0 % (309 of 322) | 93.1 % (188 of 202) | 100.0 % (4 of 4) |
Aromatic | 44.4 % (8 of 18) | 88.9 % (8 of 9) | 0.0 % (0 of 9) | |
Methyl | 97.5 % (117 of 120) | 100.0 % (60 of 60) | 95.0 % (57 of 60) |
1. DraK
GSETRTISST AQERVDLEAV RLASIVDSRL IGTGSVDEDF LREQIRDARY AVIRIPGQPV VEVGTKPTGD VLQGRATGEE GETVLVEEPRSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Bruker Avance - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | DraK | [U-13C; U-15N] | 1 mM | |
2 | H2O | natural abundance | 90 % | |
3 | D2O | natural abundance | 10 % | |
4 | sodium acetate | natural abundance | 10 mM | |
5 | NaCl | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, RDC restraints | combined_19707_2mj6.nef |
Input source #2: Coordindates | 2mj6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90 GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 90 | 0 | 0 | 100.0 |
Content subtype: combined_19707_2mj6.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90 GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 507 | 499 | 98.4 |
13C chemical shifts | 382 | 361 | 94.5 |
15N chemical shifts | 100 | 93 | 93.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 185 | 184 | 99.5 |
13C chemical shifts | 180 | 175 | 97.2 |
15N chemical shifts | 86 | 85 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 322 | 315 | 97.8 |
13C chemical shifts | 202 | 186 | 92.1 |
15N chemical shifts | 14 | 8 | 57.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 60 | 60 | 100.0 |
13C chemical shifts | 60 | 55 | 91.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 9 | 8 | 88.9 |
13C chemical shifts | 9 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90 GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90 GSETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDEDFLREQIRDARYAVIRIPGQPVVEVGTKPTGDVLQGRATGEEGETVLVEEPR |||||||||||||||||||||||||||||||||||||| |||||||| |||||| | ||||||| ||||||||||||||||||||| | .SETRTISSTAQERVDLEAVRLASIVDSRLIGTGSVDED.LREQIRDA.YAVIRI.G..VVEVGTK.TGDVLQGRATGEEGETVLVEE.R