Solution NMR structure of beta-adaptin appendage domain of human adaptor protein complex 4 subunit beta, Northeast Structural Genomics Consortium (NESG) Target HR8998C
MGHHHHHHSH MQELPDSGAL MLVPNRQLTA DYFEKTWLSL KVAHQQVLPW RGEFHPDTLQ MALQVVNIQT IAMSRAGSRP WKAYLSAQDD TGCLFLTELL LEPGNSEMQI SVKQNEARTE TLNSFISVLE TVIGTIEEIK S
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 93.0 % (1538 of 1653) | 94.0 % (804 of 855) | 91.2 % (588 of 645) | 95.4 % (146 of 153) |
Backbone | 94.6 % (789 of 834) | 95.1 % (269 of 283) | 94.2 % (392 of 416) | 94.8 % (128 of 135) |
Sidechain | 91.9 % (876 of 953) | 93.5 % (535 of 572) | 89.0 % (323 of 363) | 100.0 % (18 of 18) |
Aromatic | 68.0 % (87 of 128) | 79.7 % (51 of 64) | 54.1 % (33 of 61) | 100.0 % (3 of 3) |
Methyl | 99.4 % (165 of 166) | 100.0 % (83 of 83) | 98.8 % (82 of 83) |
1. HR8998C
MGHHHHHHSH MQELPDSGAL MLVPNRQLTA DYFEKTWLSL KVAHQQVLPW RGEFHPDTLQ MALQVVNIQT IAMSRAGSRP WKAYLSAQDD TGCLFLTELL LEPGNSEMQI SVKQNEARTE TLNSFISVLE TVIGTIEEIK SSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Solvent system 80% H2O/20% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC5, 4% PEG/hexanol, 80% H2O/20% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8998C | [5%-13C; U-15N] | 0.2 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DSS | natural abundance | 50 uM | |
12 | sodium azide | natural abundance | 0.02 % | |
13 | C12E5 PEG | natural abundance | 4 % | |
14 | 1-hexanol | natural abundance | 4 % |
Solvent system 80% H2O/20% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC5, Pf1 phage, 80% H2O/20% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | HR8998C | [5%-13C; U-15N] | 0.2 mM | |
16 | MES | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | DSS | natural abundance | 50 uM | |
20 | sodium azide | natural abundance | 0.02 % | |
21 | Pf1 phage | natural abundance | 12.5 mg/mL |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.2 mM HR8998C NC, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
22 | HR8998C | [U-13C; U-15N] | 0.2 mM | |
23 | MES | natural abundance | 20 mM | |
24 | sodium chloride | natural abundance | 100 mM | |
25 | calcium chloride | natural abundance | 5 mM | |
26 | DSS | natural abundance | 50 uM | |
27 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 750 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 286 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 289 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 292 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 295 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 283 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 80% H2O/20% D2O, Pressure 1 atm, Temperature 283 K, pH 6.5, Details 0.2 mM HR8998C NC5, 4% PEG/hexanol, 80% H2O/20% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | HR8998C | [5%-13C; U-15N] | 0.2 mM | |
8 | MES | natural abundance | 20 mM | |
9 | sodium chloride | natural abundance | 100 mM | |
10 | calcium chloride | natural abundance | 5 mM | |
11 | DSS | natural abundance | 50 uM | |
12 | sodium azide | natural abundance | 0.02 % | |
13 | C12E5 PEG | natural abundance | 4 % | |
14 | 1-hexanol | natural abundance | 4 % |
Varian INOVA - 600 MHz
State anisotropic, Solvent system 80% H2O/20% D2O, Pressure 1 atm, Temperature 283 K, pH 6.5, Details 0.2 mM HR8998C NC5, Pf1 phage, 80% H2O/20% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | HR8998C | [5%-13C; U-15N] | 0.2 mM | |
16 | MES | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 100 mM | |
18 | calcium chloride | natural abundance | 5 mM | |
19 | DSS | natural abundance | 50 uM | |
20 | sodium azide | natural abundance | 0.02 % | |
21 | Pf1 phage | natural abundance | 12.5 mg/mL |
Agilent DD2 - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5, Details 0.4 mM HR8998C NC5, 90% H2O/10% D2O
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | HR8998C | [5%-13C; U-15N] | 0.4 mM | |
2 | MES | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 100 mM | |
4 | calcium chloride | natural abundance | 5 mM | |
5 | DSS | natural abundance | 50 uM | |
6 | sodium azide | natural abundance | 0.02 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints, RDC restraints | combined_19709_2mj7.nef |
Input source #2: Coordindates | 2mj7.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL -------110-------120-------130-------140- LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS ||||||||||||||||||||||||||||||||||||||||| LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 141 | 0 | 0 | 100.0 |
Content subtype: combined_19709_2mj7.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........HMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL -------110-------120-------130-------140- LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS ||||||||||||||||||||||||||||||||||||||||| LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
44 | HIS | ND1 | 226.383 |
44 | HIS | NE2 | 179.723 |
55 | HIS | ND1 | 203.229 |
55 | HIS | NE2 | 172.653 |
70 | THR | HG1 | 5.402 |
86 | SER | HG | 5.109 |
97 | THR | HG1 | 4.511 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 855 | 791 | 92.5 |
13C chemical shifts | 645 | 584 | 90.5 |
15N chemical shifts | 158 | 143 | 90.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 283 | 263 | 92.9 |
13C chemical shifts | 282 | 262 | 92.9 |
15N chemical shifts | 135 | 125 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 572 | 528 | 92.3 |
13C chemical shifts | 363 | 322 | 88.7 |
15N chemical shifts | 23 | 18 | 78.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 89 | 88 | 98.9 |
13C chemical shifts | 89 | 87 | 97.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 64 | 48 | 75.0 |
13C chemical shifts | 61 | 33 | 54.1 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...........QELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL -------110-------120-------130-------140- LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS ||||||||||||||||||||||||||||||||||||||||| LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL | ||||||||||| || | | | | ||||||||||||| || || | ||||||| || | ||||||| ....................M........ADYFEKTWLSL..AH.Q.L.W....H.DTLQMALQVVNIQ.IA.SR..S..WKAYLSA.DD.G.LFLTELL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140- LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS || ||||||||| | |||||||||||||||||||| LE..NSEMQISVK.N..RTETLNSFISVLETVIGTIE -------110-------120-------130-------
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..................ALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140- LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS ||| ||||||||||||||||||||||||||||||| LEP..SEMQISVKQNEARTETLNSFISVLETVIGTI -------110-------120-------130------
RDC restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELL | |||||| ||||| |||| | ||| || ||||| ||| ||||| |||||||| || ||||| | .....................L......TADYFE..WLSLK.AHQQ.L........DTL.MA.QVVNI.TIA.SRAGS...KAYLSAQD.TG.LFLTE.L --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 -------110-------120-------130-------140- LEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS | ||||||||| | |||||| ||||| || | L.....EMQISVKQN.A.TETLNS..SVLET.IG.I -------110-------120-------130------