Transport protein A
MCGMGGISIW QLLIIAVIVV LLFGTKKLGS IGSDLGASIK GFKKAMSDDE PKQDKTSQDA DFTAKTIADK QADTNQEQAK TEDAKRHDKE QVLEHHHHHH
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 88.1 % (1010 of 1147) | 88.9 % (530 of 596) | 87.4 % (387 of 443) | 86.1 % (93 of 108) |
Backbone | 91.5 % (547 of 598) | 93.2 % (193 of 207) | 90.4 % (264 of 292) | 90.9 % (90 of 99) |
Sidechain | 85.6 % (549 of 641) | 86.6 % (337 of 389) | 86.0 % (209 of 243) | 33.3 % (3 of 9) |
Aromatic | 35.7 % (25 of 70) | 40.0 % (14 of 35) | 29.4 % (10 of 34) | 100.0 % (1 of 1) |
Methyl | 97.2 % (103 of 106) | 98.1 % (52 of 53) | 96.2 % (51 of 53) |
1. entity
MCGMGGISIW QLLIIAVIVV LLFGTKKLGS IGSDLGASIK GFKKAMSDDE PKQDKTSQDA DFTAKTIADK QADTNQEQAK TEDAKRHDKE QVLEHHHHHHSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein A | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | DPC | natural abundance | 80 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | transport protein A | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | DPC | natural abundance | 80 mM | |
4 | H2O | natural abundance | 90 % | |
5 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Bruker Avance - 500 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 308 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | transport protein A | [U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 50 mM | |
8 | DPC | natural abundance | 80 mM | |
9 | H2O | natural abundance | 90 % | |
10 | D2O | [U-100% 2H] | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19714_2mn6.nef |
Input source #2: Coordindates | 2mn6.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MCGMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MCGMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQVLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MCGMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQVLEHHHHHH |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MCGMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQVLEHHHHHH --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | B | 100 | 0 | 0 | 100.0 |
B | A | 100 | 0 | 0 | 100.0 |
Content subtype: combined_19714_2mn6.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- MCGMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQVLEHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQVLE -----------10--------20--------30--------40--------50--------60--------70--------80--------90-
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 596 | 520 | 87.2 |
13C chemical shifts | 443 | 378 | 85.3 |
15N chemical shifts | 109 | 90 | 82.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 207 | 186 | 89.9 |
13C chemical shifts | 200 | 171 | 85.5 |
15N chemical shifts | 99 | 87 | 87.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 389 | 334 | 85.9 |
13C chemical shifts | 243 | 207 | 85.2 |
15N chemical shifts | 10 | 3 | 30.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 54 | 96.4 |
13C chemical shifts | 56 | 53 | 94.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 35 | 13 | 37.1 |
13C chemical shifts | 34 | 10 | 29.4 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
Dihedral angle restraints