Solution structure of peptidyl-tRNA hyrolase from Vibrio cholerae
MVSQPIKLLV GLANPGPEYA KTRHNAGAWV VEELARIHNV TLKNEPKFFG LTGRLLINSQ ELRVLIPTTF MNLSGKAIAA LANFYQIKPE EIMVAHDELD LPPGVAKFKQ GGGHGGHNGL KDTISKLGNN KEFYRLRLGI GHPGHKDKVA GYVLGKAPAK EQECLDAAVD ESVRCLEILM KDGLTKAQNR LHTFKAE
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.1 % (2097 of 2301) | 89.7 % (1077 of 1201) | 93.3 % (835 of 895) | 90.2 % (185 of 205) |
Backbone | 97.6 % (1134 of 1162) | 97.3 % (393 of 404) | 97.7 % (558 of 571) | 97.9 % (183 of 187) |
Sidechain | 86.4 % (1137 of 1316) | 85.8 % (684 of 797) | 90.0 % (451 of 501) | 11.1 % (2 of 18) |
Aromatic | 71.2 % (104 of 146) | 71.2 % (52 of 73) | 72.2 % (52 of 72) | 0.0 % (0 of 1) |
Methyl | 97.5 % (230 of 236) | 99.2 % (117 of 118) | 95.8 % (113 of 118) |
1. VcPth
MVSQPIKLLV GLANPGPEYA KTRHNAGAWV VEELARIHNV TLKNEPKFFG LTGRLLINSQ ELRVLIPTTF MNLSGKAIAA LANFYQIKPE EIMVAHDELD LPPGVAKFKQ GGGHGGHNGL KDTISKLGNN KEFYRLRLGI GHPGHKDKVA GYVLGKAPAK EQECLDAAVD ESVRCLEILM KDGLTKAQNR LHTFKAESolvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | VcPth | [U-100% 15N] | 0.9 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | DTT | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | VcPth | [U-100% 15N] | 0.9 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | DTT | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | VcPth | [U-100% 15N] | 0.9 mM | |
9 | sodium phosphate | natural abundance | 20 mM | |
10 | sodium chloride | natural abundance | 50 mM | |
11 | sodium azide | natural abundance | 0.1 % | |
12 | DTT | natural abundance | 1 mM | |
13 | H2O | natural abundance | 93 % | |
14 | D2O | natural abundance | 7 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 93% H2O/7% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
2 | sodium phosphate | natural abundance | 20 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | sodium azide | natural abundance | 0.1 % | |
5 | DTT | natural abundance | 1 mM | |
6 | H2O | natural abundance | 93 % | |
7 | D2O | natural abundance | 7 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 100% D2O, Pressure 1 atm, Temperature 273 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
15 | VcPth | [U-100% 13C; U-100% 15N] | 0.9 mM | |
16 | sodium phosphate | natural abundance | 20 mM | |
17 | sodium chloride | natural abundance | 50 mM | |
18 | sodium azide | natural abundance | 0.1 % | |
19 | DTT | natural abundance | 1 mM | |
20 | D2O | natural abundance | 100 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19731_2mjl.nef |
Input source #2: Coordindates | 2mjl.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELD -------110-------120-------130-------140-------150-------160-------170-------180-------190------- LPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 197 | 0 | 0 | 100.0 |
Content subtype: combined_19731_2mjl.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELD |||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MVSQPIKLLVGLAN..PEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELD -------110-------120-------130-------140-------150-------160-------170-------180-------190------- LPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE | ||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| L.PGVAKFKQGGGHGGHNGLKDTISKLGN.KEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1201 | 1052 | 87.6 |
13C chemical shifts | 895 | 826 | 92.3 |
15N chemical shifts | 213 | 182 | 85.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 404 | 393 | 97.3 |
13C chemical shifts | 394 | 384 | 97.5 |
15N chemical shifts | 187 | 182 | 97.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 797 | 659 | 82.7 |
13C chemical shifts | 501 | 442 | 88.2 |
15N chemical shifts | 26 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 122 | 117 | 95.9 |
13C chemical shifts | 122 | 113 | 92.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 73 | 51 | 69.9 |
13C chemical shifts | 72 | 50 | 69.4 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELD |||| |||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| MVSQ.IKLLVGLANP.PEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLI.TTFMNLSGKAIAALANFYQIKPEEIMVAHDELD -------110-------120-------130-------140-------150-------160-------170-------180-------190------- LPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE | ||||||||||||||||||||||||||| |||||||||||| | ||||||||||||||||||||||||||||||||||||||||||||||||||| L.PGVAKFKQGGGHGGHNGLKDTISKLGN.KEFYRLRLGIGH..H.DKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE
Dihedral angle restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MVSQPIKLLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIPTTFMNLSGKAIAALANFYQIKPEEIMVAHDELD ||||||||||||| |||||||||||||||||||||||||||||| |||||||||||||||||| |||||||||||||||||||||||||||||||| ..SQPIKLLVGLANP.PEYAKTRHNAGAWVVEELARIHNVTLKNEP...GLTGRLLINSQELRVLIP.TFMNLSGKAIAALANFYQIKPEEIMVAHDELD -------110-------120-------130-------140-------150-------160-------170-------180-------190------- LPPGVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE || |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| LP.GVAKFKQGGGHGGHNGLKDTISKLGNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKAQNRLHTFKAE