NMR structure of p75 transmembrane domain C257A mutant in DPC micelles
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.3 % (387 of 482) | 89.1 % (220 of 247) | 66.1 % (125 of 189) | 91.3 % (42 of 46) |
Backbone | 82.0 % (200 of 244) | 98.8 % (82 of 83) | 64.5 % (78 of 121) | 100.0 % (40 of 40) |
Sidechain | 80.9 % (224 of 277) | 84.1 % (138 of 164) | 78.5 % (84 of 107) | 33.3 % (2 of 6) |
Aromatic | 15.8 % (6 of 38) | 31.6 % (6 of 19) | 0.0 % (0 of 18) | 0.0 % (0 of 1) |
Methyl | 98.3 % (59 of 60) | 100.0 % (30 of 30) | 96.7 % (29 of 30) |
1. entity
MTRGTTDNLI PVYASILAAV VVGLVAYIAF KRWNSSKQNK QSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.9
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | p75-TM-C257A | [U-100% 13C; U-100% 15N] | 1.5 mM | |
2 | DPC | [U-98% 2H] | 30 mM | |
3 | sodium phosphate | natural abundance | 20 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19741_2mjo.nef |
Input source #2: Coordindates | 2mjo.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40- MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ ||||||||||||||||||||||||||||||||||||||||| MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ
-------110-------120-------130-------140- MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ ||||||||||||||||||||||||||||||||||||||||| MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ --------10--------20--------30--------40-
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 41 | 0 | 0 | 100.0 |
B | B | 41 | 0 | 0 | 100.0 |
Content subtype: combined_19741_2mjo.nef
Assigned chemical shifts
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 247 | 219 | 88.7 |
13C chemical shifts | 189 | 125 | 66.1 |
15N chemical shifts | 48 | 42 | 87.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 83 | 81 | 97.6 |
13C chemical shifts | 82 | 41 | 50.0 |
15N chemical shifts | 40 | 40 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 164 | 138 | 84.1 |
13C chemical shifts | 107 | 84 | 78.5 |
15N chemical shifts | 8 | 2 | 25.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 31 | 30 | 96.8 |
13C chemical shifts | 31 | 29 | 93.5 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 19 | 6 | 31.6 |
13C chemical shifts | 18 | 0 | 0.0 |
15N chemical shifts | 1 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40- MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ || |||||||||||||||||||||||||||||||||| | .TR.TTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQ.K --------10--------20--------30--------40
Dihedral angle restraints
--------10--------20--------30--------40- MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ ||||||||||||||||||||||||||||||||||||||||| MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ