Solution structure of ORF2
GPVQESVTMD GKQYSTIEVN GQTYLIPDNG SKKRVARSLD SKVPQQTLRR GDVLMQGAAS PELTVSGTLL VEADDASAKA LATRHGLNFK QSSGGIALLE AKPGTDLNAI ATKLKSEGVN VQIELSGAEQ QPK
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 81.2 % (1191 of 1466) | 83.6 % (638 of 763) | 77.2 % (433 of 561) | 84.5 % (120 of 142) |
Backbone | 87.0 % (684 of 786) | 91.9 % (251 of 273) | 81.1 % (313 of 386) | 94.5 % (120 of 127) |
Sidechain | 77.4 % (619 of 800) | 79.0 % (387 of 490) | 78.6 % (232 of 295) | 0.0 % (0 of 15) |
Aromatic | 0.0 % (0 of 30) | 0.0 % (0 of 15) | 0.0 % (0 of 15) | |
Methyl | 85.6 % (137 of 160) | 91.3 % (73 of 80) | 80.0 % (64 of 80) |
1. entity
GPVQESVTMD GKQYSTIEVN GQTYLIPDNG SKKRVARSLD SKVPQQTLRR GDVLMQGAAS PELTVSGTLL VEADDASAKA LATRHGLNFK QSSGGIALLE AKPGTDLNAI ATKLKSEGVN VQIELSGAEQ QPKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.67 ppm | internal | indirect | 0.2515 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | water | protons | 4.67 ppm | internal | indirect | 0.1013 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.67 ppm | internal | indirect | 0.2515 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | water | protons | 4.67 ppm | internal | indirect | 0.1013 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.67 ppm | internal | indirect | 0.2515 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | water | protons | 4.67 ppm | internal | indirect | 0.1013 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | protons | 4.67 ppm | internal | indirect | 0.2515 |
1H | water | protons | 4.67 ppm | internal | direct | 1.0 |
15N | water | protons | 4.67 ppm | internal | indirect | 0.1013 |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Varian INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ORF2 | [U-99% 13C; U-99% 15N] | 0.9 mM | |
2 | MOPS | natural abundance | 18 mM | |
3 | H2O | natural abundance | 90 % | |
4 | D2O | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19751_2mk4.nef |
Input source #2: Coordindates | 2mk4.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GPVQESVTMDGKQYSTIEVNGQTYLIPDNGSKKRVARSLDSKVPQQTLRRGDVLMQGAASPELTVSGTLLVEADDASAKALATRHGLNFKQSSGGIALLE |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GPVQESVTMDGKQYSTIEVNGQTYLIPDNGSKKRVARSLDSKVPQQTLRRGDVLMQGAASPELTVSGTLLVEADDASAKALATRHGLNFKQSSGGIALLE --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 100-------110-------120-------130 AKPGTDLNAIATKLKSEGVNVQIELSGAEQQPK ||||||||||||||||||||||||||||||||| AKPGTDLNAIATKLKSEGVNVQIELSGAEQQPK -------110-------120-------130---
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 133 | 0 | 0 | 100.0 |
Content subtype: combined_19751_2mk4.nef
Assigned chemical shifts
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GPVQESVTMDGKQYSTIEVNGQTYLIPDNGSKKRVARSLDSKVPQQTLRRGDVLMQGAASPELTVSGTLLVEADDASAKALATRHGLNFKQSSGGIALLE |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ...QESVTMDGKQYSTIEVNGQTYL.PDNGSKKRVARSLDSKVPQQTLRRGDVLMQGAASPELTVSGTLLVEADDASAKALATRHGLNFKQSSGGIALLE 100-------110-------120-------130 AKPGTDLNAIATKLKSEGVNVQIELSGAEQQPK ||||||||||||||||||||||||||||||||| AKPGTDLNAIATKLKSEGVNVQIELSGAEQQPK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 763 | 646 | 84.7 |
13C chemical shifts | 561 | 416 | 74.2 |
15N chemical shifts | 147 | 119 | 81.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 273 | 255 | 93.4 |
13C chemical shifts | 266 | 191 | 71.8 |
15N chemical shifts | 127 | 119 | 93.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 490 | 391 | 79.8 |
13C chemical shifts | 295 | 225 | 76.3 |
15N chemical shifts | 20 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 74 | 90.2 |
13C chemical shifts | 82 | 60 | 73.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 15 | 0 | 0.0 |
13C chemical shifts | 15 | 0 | 0.0 |
Distance restraints
-----------10--------20--------30--------40--------50--------60--------70--------80--------90------- GPVQESVTMDGKQYSTIEVNGQTYLIPDNGSKKRVARSLDSKVPQQTLRRGDVLMQGAASPELTVSGTLLVEADDASAKALATRHGLNFKQSSGGIALLE |||| |||| || |||||||||| ||| ||||||||| ||||||||||||||||||||||||||||||||||||||||||| ....ESVT.DGKQ..TI............GSKKRVARSL..KVP.QTLRRGDVL...AASPELTVSGTLLVEADDASAKALATRHGLNFKQSSGGIALLE 100-------110-------120-------130 AKPGTDLNAIATKLKSEGVNVQIELSGAEQQPK || |||||||||||||||||||||||||||||| AK.GTDLNAIATKLKSEGVNVQIELSGAEQQPK
Dihedral angle restraints