Structural and biochemical characterization of Jaburetox
MGPVNEANCK AAMEIVCRRE FGHKEEEDAS EGVTTGDPDC PFTKAIPREE YANKYGPTIG DKIRLGDTDL IAEIEKDFAL YGDESVFGGG KVI
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.4 % (806 of 1028) | 77.8 % (416 of 535) | 76.1 % (306 of 402) | 92.3 % (84 of 91) |
Backbone | 90.3 % (495 of 548) | 92.7 % (178 of 192) | 86.9 % (233 of 268) | 95.5 % (84 of 88) |
Sidechain | 68.7 % (386 of 562) | 69.4 % (238 of 343) | 68.5 % (148 of 216) | 0.0 % (0 of 3) |
Aromatic | 2.9 % (2 of 68) | 5.9 % (2 of 34) | 0.0 % (0 of 34) | |
Methyl | 91.9 % (79 of 86) | 95.3 % (41 of 43) | 88.4 % (38 of 43) |
1. Jbtx
MGPVNEANCK AAMEIVCRRE FGHKEEEDAS EGVTTGDPDC PFTKAIPREE YANKYGPTIG DKIRLGDTDL IAEIEKDFAL YGDESVFGGG KVISolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbons | 4.73 ppm | internal | indirect | 0.2514 |
1H | water | protons | 4.73 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 4.73 ppm | internal | indirect | 0.101 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbons | 4.73 ppm | internal | indirect | 0.2514 |
1H | water | protons | 4.73 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 4.73 ppm | internal | indirect | 0.101 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbons | 4.73 ppm | internal | indirect | 0.2514 |
1H | water | protons | 4.73 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 4.73 ppm | internal | indirect | 0.101 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | water | methyl carbons | 4.73 ppm | internal | indirect | 0.2514 |
1H | water | protons | 4.73 ppm | internal | direct | 1.0 |
15N | water | nitrogen | 4.73 ppm | internal | indirect | 0.101 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Jbtx | [U-99% 13C; U-99% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | EDTA | natural abundance | 1 mM | |
4 | TCEP | natural abundance | 1 mM | |
5 | D2O | natural abundance | 5 % | |
6 | H2O | natural abundance | 95 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19830_2mm8.nef |
Input source #2: Coordindates | 2mm8.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGPVNEANCKAAMEIVCRREFGHKEEEDASEGVTTGDPDCPFTKAIPREEYANKYGPTIGDKIRLGDTDLIAEIEKDFALYGDESVFGGGKVIHHHHHH ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MGPVNEANCKAAMEIVCRREFGHKEEEDASEGVTTGDPDCPFTKAIPREEYANKYGPTIGDKIRLGDTDLIAEIEKDFALYGDESVFGGGKVIHHHHHH
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 99 | 0 | 0 | 100.0 |
Content subtype: combined_19830_2mm8.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGPVNEANCKAAMEIVCRREFGHKEEEDASEGVTTGDPDCPFTKAIPREEYANKYGPTIGDKIRLGDTDLIAEIEKDFALYGDESVFGGGKVIHHHHHH |||||||||||||||||||||||||||||||||| || ||||| | ||||||| |||| ||||||||||||||||||||||||||||||| ...VNEANCKAAMEIVCRREFGHKEEEDASEGVTTGD.DC.FTKAI.R.EYANKYG.TIGD.IRLGDTDLIAEIEKDFALYGDESVFGGGKVI --------10--------20--------30--------40--------50--------60--------70--------80--------90---
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 571 | 405 | 70.9 |
13C chemical shifts | 432 | 297 | 68.8 |
15N chemical shifts | 101 | 84 | 83.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 204 | 178 | 87.3 |
13C chemical shifts | 198 | 154 | 77.8 |
15N chemical shifts | 94 | 84 | 89.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 367 | 227 | 61.9 |
13C chemical shifts | 234 | 143 | 61.1 |
15N chemical shifts | 7 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 45 | 41 | 91.1 |
13C chemical shifts | 45 | 38 | 84.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 0 | 0.0 |
13C chemical shifts | 46 | 0 | 0.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90--------- MGPVNEANCKAAMEIVCRREFGHKEEEDASEGVTTGDPDCPFTKAIPREEYANKYGPTIGDKIRLGDTDLIAEIEKDFALYGDESVFGGGKVIHHHHHH |||||||||| ||||||||||||||||||||||| || ||||| | ||||||| ||| |||||||||||||| |||||||||||||||| ...VNEANCKAAM.IVCRREFGHKEEEDASEGVTTGD.DC.FTKAI.R.EYANKYG.TIG..IRLGDTDLIAEIEK.FALYGDESVFGGGKVI --------10--------20--------30--------40--------50--------60--------70--------80--------90---