BMRBj - BMREntryMaster

In response to the declaration of global pandemic of Coronavirus infectious disease 2019 (COVID-19) caused by Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), we provide comprehensive content on Coronavirus molecular structures and its interactions:

Found 1 Document (0.679 seconds)

BMRB: 19845

2MM4

Structure of a Conserved Golgi Complex-targeting Signal in Coronavirus Envelope Proteins

Authors

Li, Y., Surya, W., Claudine, S., Torres, J.

Assembly

Coronavirus Envelope Proteins-1

Entity

1. Coronavirus Envelope Proteins-1 (polymer, Thiol state: not present), 58 monomers, 6309.563 Da Detail

ETGTLIVNSV LLFLAFVVFL LVTLAILTAL RLAAYAANIV NVSLVKPTVY VYSRVKNL

Formula weight

6309.563 Da

Source organism

Severe acute respiratory syndrome-related coronavirus

Exptl. method

Refine. method

torsion angle dynamics

Data set

assigned_chemical_shifts

Chem. Shift Complete

Sequence coverage: 100.0 %, Completeness: 94.3 %, Completeness (bb): 97.4 % Detail

Polymer type: polypeptide(L)

	Total	¹H	¹³C	¹⁵N
All	94.3 % (649 of 688)	95.6 % (327 of 342)	91.6 % (261 of 285)	100.0 % (61 of 61)
Backbone	97.4 % (337 of 346)	96.6 % (112 of 116)	97.1 % (168 of 173)	100.0 % (57 of 57)
Sidechain	92.5 % (369 of 399)	95.1 % (215 of 226)	88.8 % (150 of 169)	100.0 % (4 of 4)
Aromatic	64.8 % (35 of 54)	88.9 % (24 of 27)	40.7 % (11 of 27)
Methyl	94.5 % (121 of 128)	93.8 % (60 of 64)	95.3 % (61 of 64)

1. entity

ETGTLIVNSV LLFLAFVVFL LVTLAILTAL RLAAYAANIV NVSLVKPTVY VYSRVKNL

Show sample condition

Sample

Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

Protein Blocks Logo

Calculated from 15 models in PDB: 2MM4, Strand ID: A Detail

Release date

2014-03-30

Citation

Structure of a conserved Golgi complex-targeting signal in coronavirus envelope proteins
Li, Y., Surya, W., Claudine, S., Torres, J.
J. Biol. Chem. (2014), 289, 12535-12549, PubMed 24668816 , DOI 10.1074/jbc.M114.560094 , Abstract

Related entities 1. Coronavirus Envelope Proteins-1, : 1 : 1 : 2 : 7 entities Detail

Experiments performed 8 experiments Detail

1 2D 1H-15N HSQC

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

2 3D HNCA

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

3 3D HN(CO)CA

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

4 3D HNCO

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

5 3D HCCH-TOCSY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

6 3D 1H-13C NOESY

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

7 3D 1H-13C NOESY aliphatic

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

8 3D 1H-13C NOESY aromatic

Instrument

Bruker Avance - 700 MHz

Sample

State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 318 K, pH 5.5

#	Name	Isotope labeling	Type	Concentration
1	Coronavirus Envelope Proteins	[U-99% 13C; U-99% 15N]		0.8 mM
2	DSS	natural abundance		0.1 mM
3	D2O	[U-99% 2H]		5 %
4	SDS	natural abundance		50 mM
5	sodium phosphate	natural abundance		20 mM
6	sodium chloride	natural abundance		50 mM

NMR combined restraints 3 contents Detail

Properties

Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints	combined_19845_2mm4.nef
Input source #2: Coordindates	2mm4.cif
Diamagnetism of the molecular assembly	True (excluding Oxygen atoms)
Whether the assembly has a disulfide bond	None
Whether the assembly has a other bond	None
Whether the assembly contains a cyclic polymer	None
Overall data processing status	Warning

Disulfide bonds

None

Other bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)

None

Non-standard residues

None

Sequence alignments

Entity_assembly_ID (NMR): A vs Auth_asym_ID (model): A

--10-------20--------30--------40--------50--------60-----
ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL
--------10--------20--------30--------40--------50--------

Chain assignments

Entity_assembly_ID (NMR)	Auth_asym_ID (model)	Length	Unmapped	Conflict	Sequence coverage (%)
A	A	58	0	0	100.0

Content subtype: combined_19845_2mm4.nef

#	Content subtype	Saveframe	Status	# of rows (sets)	Experiment type	Sequence coverage (%)
1	Assigned chemical shifts	assigned_chem_shift_list_1	Warning	660		100.0 (chain: A, length: 58)
1	Distance restraints	DYANA/DIANA_distance_constraints_2	OK	989 (1)	noe	100.0 (chain: A, length: 58)

Assigned chemical shifts

Saveframe: assigned_chem_shift_list_1
- Status: Warning
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 58, Sequence coverage: 100.0%
- Total number of assignments
  - ¹H chemical shifts: 337
  - ¹³C chemical shifts: 260
  - ¹⁵N chemical shifts: 63
- Completeness of assignments
  - Entity_assemble_ID: A
- Peptide bond of PRO
- Rotameric state of ILE , LEU, and VAL
- Histogram of normalized assigned chemical shifts
- Random coil index and derived parameters (S² and NMR RMSD)
  - Chain_ID: A

Distance restraints

Saveframe: DYANA/DIANA_distance_constraints_2
- Status: OK
- Experiment type: noe
- Sequence coverage of experimental data
  - Entity_assembly_ID: A, Chain length: 58, Sequence coverage: 100.0%
- Total number of restraints: 989
- Weight of restraints: 1.0 (989)
- Potential type of restraints: upper-bound-parabolic (989)
- Range of distance target values: 2.4, 5.5 (Å)
- Histogram of distance target values
- Distance restraints per residue
  - Chain_ID: A
- Distance restraints on contact map

Keywords envelope protein, membrane protein, SARS coronavirus