NMR structure of the protein YP_001712342.1 from Acinetobacter baumannii
GTDFGTTNNF VSPNLQLKQN VLPPTPKNIP LPAFGQRIIG WGTGAEGARQ RLENIQPADV SMIKKQGTTL EMITAWQDFY EQEQQRNENN PTAKYRARLM KKIADLW
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 87.4 % (1127 of 1289) | 94.3 % (642 of 681) | 76.0 % (370 of 487) | 95.0 % (115 of 121) |
Backbone | 82.6 % (517 of 626) | 97.7 % (209 of 214) | 67.4 % (211 of 313) | 98.0 % (97 of 99) |
Sidechain | 92.9 % (708 of 762) | 92.7 % (433 of 467) | 94.1 % (257 of 273) | 81.8 % (18 of 22) |
Aromatic | 83.7 % (77 of 92) | 84.8 % (39 of 46) | 81.4 % (35 of 43) | 100.0 % (3 of 3) |
Methyl | 96.2 % (102 of 106) | 96.2 % (51 of 53) | 96.2 % (51 of 53) |
1. entity
GTDFGTTNNF VSPNLQLKQN VLPPTPKNIP LPAFGQRIIG WGTGAEGARQ RLENIQPADV SMIKKQGTTL EMITAWQDFY EQEQQRNENN PTAKYRARLM KKIADLWSolvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Bruker Avance - 600 MHz
State isotropic, Solvent system 95% H2O/5% D2O, Pressure 1 atm, Temperature 298 K, pH 6.0
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | entity | [U-98% 13C; U-98% 15N] | 1.2 mM | |
2 | sodium chloride | natural abundance | 50 mM | |
3 | sodium phosphate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 5 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19851_2mmb.nef |
Input source #2: Coordindates | 2mmb.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLM ------- KKIADLW ||||||| KKIADLW
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 107 | 0 | 0 | 100.0 |
Content subtype: combined_19851_2mmb.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLM ------- KKIADLW ||||||| KKIADLW
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 681 | 642 | 94.3 |
13C chemical shifts | 487 | 362 | 74.3 |
15N chemical shifts | 127 | 115 | 90.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 214 | 209 | 97.7 |
13C chemical shifts | 214 | 105 | 49.1 |
15N chemical shifts | 99 | 97 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 467 | 433 | 92.7 |
13C chemical shifts | 273 | 257 | 94.1 |
15N chemical shifts | 28 | 18 | 64.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 56 | 54 | 96.4 |
13C chemical shifts | 56 | 54 | 96.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 46 | 39 | 84.8 |
13C chemical shifts | 43 | 35 | 81.4 |
15N chemical shifts | 3 | 3 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 GTDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLM |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ..DFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLM ------- KKIADLW ||||||| KKIADLW