ZapA mutant dimer from B. stearothermophilus
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 78.9 % (818 of 1037) | 86.0 % (468 of 544) | 67.9 % (275 of 405) | 85.2 % (75 of 88) |
Backbone | 77.2 % (392 of 508) | 91.2 % (156 of 171) | 63.1 % (161 of 255) | 91.5 % (75 of 82) |
Sidechain | 82.0 % (502 of 612) | 83.6 % (312 of 373) | 81.5 % (190 of 233) | 0.0 % (0 of 6) |
Aromatic | 51.6 % (33 of 64) | 68.8 % (22 of 32) | 34.4 % (11 of 32) | |
Methyl | 90.2 % (92 of 102) | 90.2 % (46 of 51) | 90.2 % (46 of 51) |
1. ZapA
GSHMTEQPKT RVSVRIYGQD YTIVGAESPA HIRLVAAFVD DKMHEFSEKQ PMLDVPKLAV LTAVQIASEY LKLKEEYQRL REQLKKSolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [U-13C, 15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | ZapA | [U-13C; U-15N] | 0.3 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | potassium chloride | natural abundance | 50 mM |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details Before the acquisition, this mixture was lyophilized and resuspended in deuterium.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | ZapA | [U-13C; U-15N] | 0.3 mM | |
8 | ZapA | natural abundance | 0.3 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | potassium chloride | natural abundance | 50 mM |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker AVANCE - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [U-13C, 15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | ZapA | [U-13C; U-15N] | 0.3 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [U-13C, 15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
4 | ZapA | [U-13C; U-15N] | 0.3 mM | |
5 | sodium phosphate | natural abundance | 50 mM | |
6 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details Before the acquisition, this mixture was lyophilized and resuspended in deuterium.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | ZapA | [U-13C; U-15N] | 0.3 mM | |
8 | ZapA | natural abundance | 0.3 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | potassium chloride | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details Before the acquisition, this mixture was lyophilized and resuspended in deuterium.
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
7 | ZapA | [U-13C; U-15N] | 0.3 mM | |
8 | ZapA | natural abundance | 0.3 mM | |
9 | sodium phosphate | natural abundance | 50 mM | |
10 | potassium chloride | natural abundance | 50 mM |
Bruker AVANCE - 900 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Agilent INOVA - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 6.8, Details 0.3 MM [15N]; Mutant
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | ZapA | [U-15N] | 0.3 mM | |
2 | sodium phosphate | natural abundance | 50 mM | |
3 | potassium chloride | natural abundance | 50 mM |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19869_2mmv.nef |
Input source #2: Coordindates | 2mmv.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80------ GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK
--------10--------20--------30--------40--------50--------60--------70--------80------ GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 86 | 0 | 0 | 100.0 |
B | B | 86 | 0 | 0 | 100.0 |
Content subtype: combined_19869_2mmv.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80------ GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......PKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 544 | 463 | 85.1 |
13C chemical shifts | 405 | 266 | 65.7 |
15N chemical shifts | 93 | 74 | 79.6 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 171 | 155 | 90.6 |
13C chemical shifts | 172 | 79 | 45.9 |
15N chemical shifts | 82 | 74 | 90.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 373 | 308 | 82.6 |
13C chemical shifts | 233 | 187 | 80.3 |
15N chemical shifts | 11 | 0 | 0.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 54 | 46 | 85.2 |
13C chemical shifts | 54 | 46 | 85.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 32 | 22 | 68.8 |
13C chemical shifts | 32 | 11 | 34.4 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80------ GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......PKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK
--------10--------20--------30--------40--------50--------60--------70--------80------ GSHMTEQPKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .......PKTRVSVRIYGQDYTIVGAESPAHIRLVAAFVDDKMHEFSEKQPMLDVPKLAVLTAVQIASEYLKLKEEYQRLREQLKK