hIFABP-oleate complex
AHHHHHHVGT QAFDSTWKVD RSENYDKFME KMGVNIVKRK LAAHDNLKLT ITQEGNKFTV KESSAFRNIE VVFELGVTFN YNLADGTELR GTWSLEGNKL IGKFKRTDNG NELNTVREII GDELVQTYVY EGVEAKRIFK KD
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 84.2 % (1428 of 1695) | 88.6 % (780 of 880) | 75.6 % (497 of 657) | 95.6 % (151 of 158) |
Backbone | 83.2 % (709 of 852) | 93.2 % (275 of 295) | 72.0 % (299 of 415) | 95.1 % (135 of 142) |
Sidechain | 86.6 % (843 of 974) | 86.3 % (505 of 585) | 86.3 % (322 of 373) | 100.0 % (16 of 16) |
Aromatic | 73.8 % (121 of 164) | 75.6 % (62 of 82) | 71.2 % (57 of 80) | 100.0 % (2 of 2) |
Methyl | 98.7 % (150 of 152) | 98.7 % (75 of 76) | 98.7 % (75 of 76) |
1. hIFABP
AHHHHHHVGT QAFDSTWKVD RSENYDKFME KMGVNIVKRK LAAHDNLKLT ITQEGNKFTV KESSAFRNIE VVFELGVTFN YNLADGTELR GTWSLEGNKL IGKFKRTDNG NELNTVREII GDELVQTYVY EGVEAKRIFK KDSolvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 13C sodium oleate
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OLEIC ACID | [U-100% 13C] | 0.5 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | ethanol | natural abundance | 0.5 mM | |
12 | H2O | natural abundance | 90 % | |
13 | D20 | natural abundance | 10 % |
Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 15N hIFABP + 2.5 mM 13C Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | hIFABP | [U-100% 15N] | 0.8 mM | |
15 | OLEIC ACID | [U-100% 13C] | 2 mM | |
16 | sodium chloride | natural abundance | 50 mM | |
17 | MES | natural abundance | 20 mM | |
18 | methanol | natural abundance | 0.5 % | |
19 | H2O | natural abundance | 90 % | |
20 | D20 | natural abundance | 10 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | na | indirect | 0.2514495 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | na | indirect | 0.1013291 |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 15N hIFABP + 2.5 mM 13C Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | hIFABP | [U-100% 15N] | 0.8 mM | |
15 | OLEIC ACID | [U-100% 13C] | 2 mM | |
16 | sodium chloride | natural abundance | 50 mM | |
17 | MES | natural abundance | 20 mM | |
18 | methanol | natural abundance | 0.5 % | |
19 | H2O | natural abundance | 90 % | |
20 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 15N hIFABP + 2.5 mM 13C Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
14 | hIFABP | [U-100% 15N] | 0.8 mM | |
15 | OLEIC ACID | [U-100% 13C] | 2 mM | |
16 | sodium chloride | natural abundance | 50 mM | |
17 | MES | natural abundance | 20 mM | |
18 | methanol | natural abundance | 0.5 % | |
19 | H2O | natural abundance | 90 % | |
20 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 13C sodium oleate
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
8 | OLEIC ACID | [U-100% 13C] | 0.5 mM | |
9 | sodium chloride | natural abundance | 50 mM | |
10 | MES | natural abundance | 20 mM | |
11 | ethanol | natural abundance | 0.5 mM | |
12 | H2O | natural abundance | 90 % | |
13 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Temperature 298 K, pH 5.5, Details 1mM 13C15N hIFABP + 2.5 mM Sodium Oleate with less 1% MeOH
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | hIFABP | [U-100% 13C; U-100% 15N] | 1 mM | |
2 | OLEIC ACID | natural abundance | 2.5 mM | |
3 | sodium chloride | natural abundance | 50 mM | |
4 | MES | natural abundance | 20 mM | |
5 | methanol | natural abundance | 0.5 % | |
6 | H2O | natural abundance | 90 % | |
7 | D20 | natural abundance | 10 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19921_2mo5.nef |
Input source #2: Coordindates | 2mo5.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | OLA | OLEIC ACID | None |
Sequence alignments
-------------------10--------20--------30--------40--------50--------60--------70--------80--------9 AHHHHHHVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| AHHHHHHVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL --------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 0-------100-------110-------120-------130- IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |||||||||||||||||||||||||||||||||||||||||| IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD -------110-------120-------130-------140--
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 142 | 0 | 0 | 100.0 |
Content subtype: combined_19921_2mo5.nef
Assigned chemical shifts
-------------------10--------20--------30--------40--------50--------60--------70--------80--------9 AHHHHHHVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......HVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL 0-------100-------110-------120-------130- IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |||||||||||||||||||||||||||||||||||||||||| IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 880 | 784 | 89.1 |
13C chemical shifts | 657 | 454 | 69.1 |
15N chemical shifts | 165 | 158 | 95.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 295 | 282 | 95.6 |
13C chemical shifts | 284 | 136 | 47.9 |
15N chemical shifts | 142 | 135 | 95.1 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 585 | 502 | 85.8 |
13C chemical shifts | 373 | 318 | 85.3 |
15N chemical shifts | 23 | 23 | 100.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 78 | 77 | 98.7 |
13C chemical shifts | 78 | 77 | 98.7 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 82 | 57 | 69.5 |
13C chemical shifts | 80 | 53 | 66.2 |
15N chemical shifts | 2 | 2 | 100.0 |
Distance restraints
-------------------10--------20--------30--------40--------50--------60--------70--------80--------9 AHHHHHHVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ......HVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL 0-------100-------110-------120-------130- IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |||||||||||||||||||||||||||||||||||||||||| IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
Dihedral angle restraints
-------------------10--------20--------30--------40--------50--------60--------70--------80--------9 AHHHHHHVGTQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .........TQAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL 0-------100-------110-------120-------130- IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |||||||||||||||||||||||||||||||||||||||||| IGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD