holo FldA
MAITGIFFGS DTGNTENIAK MIQKQLGKDV ADVHDIAKSS KEDLEAYDIL LLGIPTWYYG EAQCDWDDFF PTLEEIDFNG KLVALFGCGD QEDYAEYFCD ALGTIRDIIE PRGATIVGHW PTAGYHFEAS KGLADDDHFV GLAIDEDRQP ELTAERVEKW VKQISEELHL DEILNA
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 91.4 % (1843 of 2016) | 89.7 % (927 of 1034) | 92.3 % (736 of 797) | 97.3 % (180 of 185) |
Backbone | 98.9 % (1034 of 1046) | 98.6 % (357 of 362) | 99.0 % (508 of 513) | 98.8 % (169 of 171) |
Sidechain | 85.6 % (968 of 1131) | 84.8 % (570 of 672) | 87.0 % (387 of 445) | 78.6 % (11 of 14) |
Aromatic | 52.4 % (108 of 206) | 54.4 % (56 of 103) | 48.5 % (48 of 99) | 100.0 % (4 of 4) |
Methyl | 98.5 % (195 of 198) | 98.0 % (97 of 99) | 99.0 % (98 of 99) |
1. entity 1
MAITGIFFGS DTGNTENIAK MIQKQLGKDV ADVHDIAKSS KEDLEAYDIL LLGIPTWYYG EAQCDWDDFF PTLEEIDFNG KLVALFGCGD QEDYAEYFCD ALGTIRDIIE PRGATIVGHW PTAGYHFEAS KGLADDDHFV GLAIDEDRQP ELTAERVEKW VKQISEELHL DEILNASolvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | DTT | natural abundance | 40 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.25145 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.10133 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.25145 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.10133 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.25145 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.10133 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.25145 |
1H | DSS | methyl protons | 0.0 ppm | internal | direct | 1.0 |
15N | DSS | methyl protons | 0.0 ppm | internal | indirect | 0.10133 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | DTT | natural abundance | 40 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | Protein | [U-100% 15N] | 1 mM | |
2 | sodium phosphate | natural abundance | 30 mM | |
3 | DTT | natural abundance | 40 mM | |
4 | D2O | natural abundance | 10 % | |
5 | H2O | natural abundance | 90 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 90% H2O/10% D2O, Pressure 1 atm, Temperature 298 K, pH 7
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
6 | Protein | [U-100% 13C; U-100% 15N] | 1 mM | |
7 | sodium phosphate | natural abundance | 30 mM | |
8 | DTT | natural abundance | 40 mM | |
9 | D2O | natural abundance | 10 % | |
10 | H2O | natural abundance | 90 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints | combined_19945_2mok.nef |
Input source #2: Coordindates | 2mok.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
Chain_ID | Seq_ID | Comp_ID | Chem_comp_name | Experimental evidences |
---|---|---|---|---|
B | 1 | FMN | FLAVIN MONONUCLEOTIDE | None |
Sequence alignments
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCD |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCD -------110-------120-------130-------140-------150-------160-------170------ ALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 176 | 0 | 0 | 100.0 |
Content subtype: combined_19945_2mok.nef
Assigned chemical shifts
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCD -------110-------120-------130-------140-------150-------160-------170------ ALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA
Comp_index_ID | Comp_ID | Atom_ID | CS value (ppm) |
---|---|---|---|
17 | ASN | CG | 175.606 |
23 | GLN | CD | 178.057 |
25 | GLN | CD | 178.168 |
79 | ASN | CG | 177.161 |
91 | GLN | CD | 181.105 |
156 | ARG | CZ | 179.193 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 1034 | 927 | 89.7 |
13C chemical shifts | 797 | 733 | 92.0 |
15N chemical shifts | 189 | 184 | 97.4 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 362 | 359 | 99.2 |
13C chemical shifts | 352 | 349 | 99.1 |
15N chemical shifts | 171 | 169 | 98.8 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 672 | 568 | 84.5 |
13C chemical shifts | 445 | 384 | 86.3 |
15N chemical shifts | 18 | 15 | 83.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 101 | 99 | 98.0 |
13C chemical shifts | 101 | 99 | 98.0 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
1H chemical shifts | 103 | 53 | 51.5 |
13C chemical shifts | 99 | 45 | 45.5 |
15N chemical shifts | 4 | 4 | 100.0 |
Distance restraints
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100 MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCD ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .AITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCD -------110-------120-------130-------140-------150-------160-------170------ ALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ALGTIRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA