Structure and function of the JAK interaction region in the intrinsically disordered N-terminus of SOCS5
Polymer type: polypeptide(L)
Total | 1H | 13C | 15N | |
---|---|---|---|---|
All | 80.1 % (693 of 865) | 84.8 % (390 of 460) | 71.3 % (238 of 334) | 91.5 % (65 of 71) |
Backbone | 82.8 % (338 of 408) | 96.3 % (131 of 136) | 69.2 % (144 of 208) | 98.4 % (63 of 64) |
Sidechain | 80.6 % (423 of 525) | 79.9 % (259 of 324) | 83.5 % (162 of 194) | 28.6 % (2 of 7) |
Aromatic | 51.5 % (34 of 66) | 51.5 % (17 of 33) | 50.0 % (16 of 32) | 100.0 % (1 of 1) |
Methyl | 90.6 % (58 of 64) | 87.5 % (28 of 32) | 93.8 % (30 of 32) |
1. entity
RSLRQRLQDT VGLCFPMRTY SKQSKPLFSN KRKIHLSELM LEKCPFPAGS DLAQKWHLIK QHTAPVSPHSSolvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | dioxane | methylene protons | 3.75 ppm | internal | direct | 1.0 |
15N | dioxane | methylene protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | dioxane | methylene protons | 3.75 ppm | internal | direct | 1.0 |
15N | dioxane | methylene protons | 0.0 ppm | internal | indirect | 0.1013291 |
Atom type | Mol. common name | Atom group | Value | Ref. method | Ref. type | Shift ratio |
---|---|---|---|---|---|---|
13C | dioxane | methylene protons | 0.0 ppm | internal | indirect | 0.2514495 |
1H | dioxane | methylene protons | 3.75 ppm | internal | direct | 1.0 |
15N | dioxane | methylene protons | 0.0 ppm | internal | indirect | 0.1013291 |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 600 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Bruker Avance - 800 MHz
State isotropic, Solvent system 94% H2O/6% D2O, Pressure 1 atm, Temperature 303 K, pH 4.5
# | Name | Isotope labeling | Type | Concentration |
---|---|---|---|---|
1 | SOCS5 JIR | [U-100% 13C; U-100% 15N] | 0.3 mM | |
2 | TCEP | natural abundance | 5 mM | |
3 | Sodium Citrate | natural abundance | 20 mM | |
4 | sodium azide | natural abundance | 0.02 % | |
5 | D2O | [U-100% 2H] | 6 % | |
6 | H2O | natural abundance | 94 % |
Properties
Input source #1: NMR data (NEF) - Assigned chemical shifts, Distance restraints, Dihedral angle restraints | combined_19966_2n34.nef |
Input source #2: Coordindates | 2n34.cif |
Diamagnetism of the molecular assembly | True (excluding Oxygen atoms) |
Whether the assembly has a disulfide bond | None |
Whether the assembly has a other bond | None |
Whether the assembly contains a cyclic polymer | None |
Overall data processing status | Warning |
Disulfide bonds
NoneOther bonds (neither disulfide, covalent nor hydrogen bonds, e.g. Zinc–sulphur bond)
NoneNon-standard residues
NoneSequence alignments
---180-------190-------200-------210-------220-------230-------240---- RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS --------10--------20--------30--------40--------50--------60--------70
Chain assignments
Entity_assembly_ID (NMR) | Auth_asym_ID (model) | Length | Unmapped | Conflict | Sequence coverage (%) |
---|---|---|---|---|---|
A | A | 70 | 0 | 0 | 100.0 |
Content subtype: combined_19966_2n34.nef
Assigned chemical shifts
---180-------190-------200-------210-------220-------230-------240---- RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 334 | 232 | 69.5 |
1H chemical shifts | 460 | 392 | 85.2 |
15N chemical shifts | 76 | 63 | 82.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 140 | 70 | 50.0 |
1H chemical shifts | 136 | 132 | 97.1 |
15N chemical shifts | 64 | 62 | 96.9 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 194 | 162 | 83.5 |
1H chemical shifts | 324 | 260 | 80.2 |
15N chemical shifts | 12 | 1 | 8.3 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 34 | 30 | 88.2 |
1H chemical shifts | 34 | 30 | 88.2 |
Atom group | # of target shifts | # of assigned shifts | Completeness (%) |
---|---|---|---|
13C chemical shifts | 32 | 16 | 50.0 |
1H chemical shifts | 33 | 17 | 51.5 |
15N chemical shifts | 1 | 1 | 100.0 |
Distance restraints
---180-------190-------200-------210-------220-------230-------240---- RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| .SLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPH ---180-------190-------200-------210-------220-------230-------240---
Dihedral angle restraints
---180-------190-------200-------210-------220-------230-------240---- RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| RSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPVSPHS